Result : Q5GSH7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | AE017321.1 |
| Organism | Wolbachia sp. subsp. Brugia malayi (strain TRS) |
| Left | 598284 |
| Right | 598511 |
| Strand | - |
| Nucleotide Sequence | ATGGATTTAGTAGCTTTAAAGTTTATAGCGATTGGTTTAAGCGTACTTGGCATACTTGGGGCAGGTCTTGGTGTAGCAAATATATTTTCTACTATGCTAAGTGGGCTTGCAAGAAACCCTGAATCGGAAGGTAAAATGAAAATTTACGTTTATGTTGGTGCTGGTATGGTTGAATTTACGGGGTTGCTCGCGTTTGTTCTTGCAATGTTATTGATGTTCGTTGCTTAA |
| Sequence | MDLVALKFIAIGLSVLGILGAGLGVANIFSTMLSGLARNPESEGKMKIYVYVGAGMVEFTGLLAFVLAMLLMFVA |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 15780005 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | Q5GSH7 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 323916 | 324143 | + | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 2 | 322611 | 322838 | + | NZ_CP047224.1 | Neorickettsia findlayensis |
| 3 | 335076 | 335303 | + | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 4 | 327213 | 327440 | + | NZ_CP007481.1 | Neorickettsia helminthoeca str. Oregon |
| 5 | 35388 | 35612 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 6 | 48390 | 48614 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 7 | 34333 | 34557 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 8 | 296083 | 296307 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 9 | 1392481 | 1392705 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| 10 | 140141 | 140365 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 11 | 22188 | 22412 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 12 | 29686 | 29910 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 13 | 27178 | 27402 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 14 | 30425 | 30649 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 15 | 30381 | 30605 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 16 | 22868 | 23092 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 17 | 1270784 | 1271008 | - | NC_021880.1 | Anaplasma phagocytophilum str. JM |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009881.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00119.22 | 1.0 | 17 | 35 | same-strand | ATP synthase A chain |
| 2 | PF02326.17 | 0.94 | 16 | 18.5 | same-strand | Plant ATP synthase F0 |
| 3 | PF00430.20 | 1.0 | 17 | 488 | same-strand | ATP synthase B/B' CF(0) |
| 4 | PF10119.11 | 0.65 | 11 | 3068 | same-strand | Predicted methyltransferase regulatory domain |
| 5 | PF08242.14 | 0.65 | 11 | 3068 | same-strand | Methyltransferase domain |
| 6 | PF13649.8 | 0.65 | 11 | 3068 | same-strand | Methyltransferase domain |
| 7 | PF08241.14 | 0.65 | 11 | 3068 | same-strand | Methyltransferase domain |
| 8 | PF02559.18 | 0.71 | 12 | 2300.0 | opposite-strand | CarD-like/TRCF domain |
| 9 | PF13462.8 | 0.71 | 12 | 1303.0 | same-strand | Thioredoxin |
| 10 | PF09527.12 | 0.71 | 12 | 912.0 | same-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
| 11 | PF05405.16 | 0.65 | 11 | 485.5 | same-strand | Mitochondrial ATP synthase B chain precursor (ATP-synt B) |
++ More..