Result : Q5FUB3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000009.1 |
| Organism | Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) |
| Left | 265276 |
| Right | 265527 |
| Strand | + |
| Nucleotide Sequence | ATGCCCGAACCCATTGATGCCATGTCTTTCGAGGATGCTCTCTCCGAACTGGAGAGGATCGTCCGCGGCCTTGAAGGCGGCCAGATGAAGCTCGAGGACGCTATTTCCGCCTATGAACGCGGTGCTGCCCTGCGCAGGCACTGTGATGCGAAGCTGGGAGAGGCCGAGATGCGTGTCCGCGCCATCGTGCAGAACGATGACGGCACGACAGGCACGGAGCCTCTTGCCGATACCGGAGAGTCCGGCCGATGA |
| Sequence | MPEPIDAMSFEDALSELERIVRGLEGGQMKLEDAISAYERGAALRRHCDAKLGEAEMRVRAIVQNDDGTTGTEPLADTGESGR |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 15665824 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q5FUB3 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 143
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 290744 | 290995 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 2 | 343894 | 344145 | + | NZ_CP068419.1 | Gluconobacter sphaericus |
| 3 | 160424 | 160675 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
| 4 | 1839225 | 1839488 | + | NZ_CP014689.1 | Gluconobacter albidus |
| 5 | 296543 | 296794 | + | NZ_CP038141.1 | Swingsia samuiensis |
| 6 | 177084 | 177335 | + | NZ_CP032485.1 | Neokomagataea tanensis |
| 7 | 723917 | 724180 | - | NZ_CP014681.1 | Kozakia baliensis |
| 8 | 1800193 | 1800453 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 9 | 354220 | 354450 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 10 | 1476740 | 1476970 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 11 | 1741683 | 1741913 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 12 | 1157207 | 1157437 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 13 | 257097 | 257309 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 14 | 3890064 | 3890294 | + | NZ_CP053708.1 | Lichenicola cladoniae |
| 15 | 3367466 | 3367696 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 16 | 1677191 | 1677421 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 17 | 2615119 | 2615355 | + | NZ_CP060244.1 | Entomobacter blattae |
| 18 | 890146 | 890376 | + | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 19 | 579917 | 580147 | + | NZ_CP019875.1 | Komagataeibacter nataicola |
| 20 | 875955 | 876221 | + | NZ_CP029352.1 | Azospirillum thermophilum |
| 21 | 3627834 | 3628085 | - | NZ_CP030265.1 | Skermanella pratensis |
| 22 | 629274 | 629555 | + | NZ_CP029831.1 | Azospirillum ramasamyi |
| 23 | 759638 | 759868 | + | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 24 | 3394655 | 3394891 | + | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 25 | 768693 | 768908 | + | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 26 | 216511 | 216774 | + | NZ_CP054616.1 | Azospirillum oryzae |
| 27 | 733507 | 733791 | + | NZ_CP012402.1 | Azospirillum thiophilum |
| 28 | 1973953 | 1974183 | + | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 29 | 1475478 | 1475702 | - | NZ_CP071057.1 | Marinicauda algicola |
| 30 | 1325498 | 1325743 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 31 | 3886728 | 3886973 | - | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 32 | 2019949 | 2020164 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 33 | 4209969 | 4210184 | - | NZ_CP042582.1 | Hypericibacter adhaerens |
| 34 | 4273175 | 4273390 | - | NZ_CP042906.1 | Hypericibacter terrae |
| 35 | 158332 | 158550 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 36 | 1132204 | 1132452 | + | NZ_CP053923.1 | Defluviicoccus vanus |
| 37 | 2003749 | 2004012 | + | NZ_CP031555.1 | Thalassospira indica |
| 38 | 3293278 | 3293493 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 39 | 1063936 | 1064193 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 40 | 2831638 | 2831853 | + | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 41 | 2148761 | 2148997 | - | NZ_CP035510.1 | Haematobacter massiliensis |
| 42 | 561328 | 561543 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 43 | 4502735 | 4502971 | + | NC_020911.1 | Octadecabacter antarcticus 307 |
| 44 | 2308196 | 2308450 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 45 | 3257995 | 3258210 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 46 | 1111858 | 1112079 | + | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 47 | 1743261 | 1743536 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 48 | 1003390 | 1003632 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 49 | 5013653 | 5013889 | + | NC_020908.1 | Octadecabacter arcticus 238 |
| 50 | 1458446 | 1458697 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 51 | 120371 | 120595 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 52 | 1255727 | 1255948 | + | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 53 | 3568339 | 3568566 | - | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 54 | 2161526 | 2161744 | - | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 55 | 1791940 | 1792182 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 56 | 1404487 | 1404744 | + | NZ_CP024199.1 | Thalassospira marina |
| 57 | 3099363 | 3099578 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 58 | 1413503 | 1413766 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 59 | 578548 | 578766 | - | NZ_CP032125.1 | Profundibacter amoris |
| 60 | 5083876 | 5084109 | - | NZ_CP026100.1 | Caulobacter flavus |
| 61 | 4115340 | 4115567 | + | NZ_CP039690.1 | Phreatobacter stygius |
| 62 | 2186041 | 2186286 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 63 | 1441077 | 1441331 | - | NZ_CP014525.1 | Haematospirillum jordaniae |
| 64 | 316968 | 317228 | + | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 65 | 2444137 | 2444352 | + | NZ_CP020470.1 | Rhodobacter blasticus |
| 66 | 1131059 | 1131277 | - | NZ_CP041690.1 | Youhaiella tibetensis |
| 67 | 840643 | 840864 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 68 | 3366482 | 3366700 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 69 | 845196 | 845456 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 70 | 2182906 | 2183124 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 71 | 1615932 | 1616150 | + | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 72 | 2255673 | 2255891 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 73 | 237107 | 237325 | - | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 74 | 474037 | 474255 | + | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 75 | 850121 | 850339 | + | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 76 | 1040913 | 1041131 | + | NZ_CP045073.1 | Paracoccus kondratievae |
| 77 | 684639 | 684860 | + | NZ_CP037948.1 | Qipengyuania sediminis |
| 78 | 3462803 | 3463021 | - | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 79 | 1583523 | 1583738 | - | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 80 | 4684915 | 4685142 | + | NC_014217.1 | Starkeya novella DSM 506 |
| 81 | 24305 | 24523 | + | NZ_CP065915.1 | Pelagovum pacificum |
| 82 | 2129661 | 2129882 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 83 | 2815881 | 2816132 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 84 | 1196248 | 1196463 | + | NZ_CP030918.1 | Paracoccus suum |
| 85 | 2154934 | 2155137 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 86 | 1459498 | 1459713 | + | NZ_CP027850.1 | Caulobacter segnis |
| 87 | 431675 | 431893 | + | NC_010103.1 | Brucella canis ATCC 23365 |
| 88 | 431674 | 431892 | + | NC_004310.3 | Brucella suis 1330 |
| 89 | 453673 | 453891 | + | NC_009505.1 | Brucella ovis ATCC 25840 |
| 90 | 433705 | 433923 | + | NC_013119.1 | Brucella microti CCM 4915 |
| 91 | 1551000 | 1551218 | - | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 92 | 1554103 | 1554321 | - | NC_022905.1 | Brucella ceti TE10759-12 |
| 93 | 449843 | 450061 | + | NC_007618.1 | Brucella abortus 2308 |
| 94 | 131678 | 131896 | - | NZ_LT605585.1 | Brucella inopinata |
| 95 | 533839 | 534057 | + | NZ_CP064063.1 | Brucella anthropi |
| 96 | 2128501 | 2128740 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 97 | 1223954 | 1224202 | + | NZ_CP016616.1 | Microvirga ossetica |
| 98 | 1458606 | 1458833 | + | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 99 | 472176 | 472394 | + | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 100 | 1351552 | 1351800 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 101 | 1357110 | 1357358 | - | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 102 | 1452690 | 1452908 | + | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 103 | 2143068 | 2143319 | + | NZ_CP012946.1 | Blastochloris viridis |
| 104 | 2002263 | 2002487 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 105 | 2489184 | 2489441 | - | NZ_CP013002.1 | Caulobacter henricii |
| 106 | 2306446 | 2306676 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 107 | 222285 | 222527 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 108 | 114599 | 114817 | + | NZ_CP034588.1 | Silicimonas algicola |
| 109 | 1492179 | 1492397 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 110 | 3470136 | 3470393 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 111 | 4235898 | 4236116 | - | NZ_CP012661.1 | Defluviimonas alba |
| 112 | 1039174 | 1039401 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 113 | 1100836 | 1101090 | - | NZ_AP019773.1 | Bartonella quintana |
| 114 | 241327 | 241563 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 115 | 2607973 | 2608200 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 116 | 3559843 | 3560100 | + | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 117 | 1396514 | 1396732 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 118 | 3574612 | 3574830 | + | NZ_CP032509.1 | Georhizobium profundi |
| 119 | 2019667 | 2019900 | - | NC_014313.1 | Hyphomicrobium denitrificans ATCC 51888 |
| 120 | 1811047 | 1811265 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 121 | 170531 | 170749 | - | NZ_CP053562.1 | Thioclava electrotropha |
| 122 | 3564508 | 3564753 | + | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 123 | 4035538 | 4035792 | - | NZ_CP046908.1 | Stappia indica |
| 124 | 2674826 | 2675044 | - | NZ_CP017940.1 | Phyllobacterium zundukense |
| 125 | 177839 | 178057 | + | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 126 | 5781905 | 5782123 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 127 | 4916431 | 4916649 | + | NZ_CP050296.1 | Mesorhizobium huakuii |
| 128 | 1303749 | 1303994 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 129 | 5758794 | 5759012 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 130 | 150543 | 150800 | - | NZ_CP010522.1 | Liberibacter crescens |
| 131 | 709142 | 709378 | - | NZ_CP024422.1 | Paracoccus yeei |
| 132 | 1187053 | 1187289 | - | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 133 | 6171959 | 6172177 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 134 | 5185064 | 5185282 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 135 | 2554338 | 2554556 | + | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 136 | 2562116 | 2562373 | - | NZ_CP017147.1 | Bosea vaviloviae |
| 137 | 2483306 | 2483521 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 138 | 2827131 | 2827349 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 139 | 2649310 | 2649561 | + | NZ_AP018907.1 | Blastochloris tepida |
| 140 | 5087948 | 5088166 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 141 | 2691394 | 2691612 | - | NZ_CP027407.1 | Roseobacter denitrificans |
| 142 | 4100617 | 4100835 | + | NC_015730.1 | Roseobacter litoralis Och 149 |
| 143 | 723358 | 723576 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029352.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00348.19 | 0.66 | 95 | 4 | same-strand | Polyprenyl synthetase |
| 2 | PF13292.8 | 0.85 | 121 | 941 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 3 | PF02779.26 | 0.85 | 122 | 943.0 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 0.86 | 123 | 945 | same-strand | Transketolase, C-terminal domain |
| 5 | PF00850.21 | 0.6 | 86 | 41 | same-strand | Histone deacetylase domain |
++ More..