Result : Q5FU58
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | CP000009.1 |
| Organism | Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) |
| Left | 322581 |
| Right | 322871 |
| Strand | - |
| Nucleotide Sequence | ATGTCCGAGACCATCACTCCCGACGTCCACGAAGTGAACCCGGCTGCCCGTCGCACGGCAGTTGGCGCACGTCGTCCGTTCTACCGTCGTCGCAAGTCCTGCCCGTTCTCCGGCCCCAACGCGCCGAAGATCGACTACAAGGACGTGCGTCTGCTGAGCCGCTTCCTTTCGGAGCGCGGCAAGATCGTGCCGAGCCGCATCACGGCCGTTTCGGCCAAGAAGCAGCGTGAGCTGGCACAGGCGATCAAGCGCGCCCGTTTCCTCGCCCTGCTCCCCTACGTCGTGAACTGA |
| Sequence | MSETITPDVHEVNPAARRTAVGARRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIKRARFLALLPYVVN |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 15665824 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q5FU58 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 115
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 348049 | 348339 | - | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 2 | 401218 | 401508 | - | NZ_CP068419.1 | Gluconobacter sphaericus |
| 3 | 1896483 | 1896773 | - | NZ_CP014689.1 | Gluconobacter albidus |
| 4 | 220307 | 220588 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 5 | 238222 | 238503 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 6 | 357417 | 357698 | - | NZ_CP038141.1 | Swingsia samuiensis |
| 7 | 964158 | 964433 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 8 | 1143137 | 1143412 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 9 | 2382452 | 2382727 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 10 | 331860 | 332144 | + | NZ_CP014681.1 | Kozakia baliensis |
| 11 | 1299875 | 1300150 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 12 | 945736 | 945999 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 13 | 2570920 | 2571183 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 14 | 599429 | 599692 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 15 | 1075734 | 1075997 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 16 | 2222753 | 2223034 | - | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 17 | 1260432 | 1260668 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 18 | 90184 | 90447 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 19 | 2485902 | 2486159 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 20 | 1261265 | 1261546 | + | NZ_CP053708.1 | Lichenicola cladoniae |
| 21 | 2700577 | 2700852 | - | NZ_CP060244.1 | Entomobacter blattae |
| 22 | 2894008 | 2894289 | - | NZ_CP044117.1 | Roseomonas mucosa |
| 23 | 1743075 | 1743362 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 24 | 1862606 | 1862881 | - | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 25 | 2666586 | 2666867 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 26 | 1091797 | 1092042 | - | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 27 | 4472519 | 4472764 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 28 | 6299667 | 6299927 | - | NZ_CP039690.1 | Phreatobacter stygius |
| 29 | 1523001 | 1523273 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 30 | 1044371 | 1044616 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 31 | 3520396 | 3520644 | + | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 32 | 1109372 | 1109620 | - | NZ_CP034998.1 | Rhizobium acidisoli |
| 33 | 1215656 | 1215904 | - | NZ_CP013107.1 | Sinorhizobium americanum |
| 34 | 1292907 | 1293155 | - | NZ_CP041238.1 | Ensifer mexicanus |
| 35 | 3089781 | 3090029 | + | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 36 | 1013984 | 1014232 | - | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 37 | 1812605 | 1812859 | - | NZ_CP041690.1 | Youhaiella tibetensis |
| 38 | 4565200 | 4565454 | + | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 39 | 3361168 | 3361416 | - | NZ_CP071454.1 | Rhizobium lentis |
| 40 | 1237868 | 1238116 | - | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 41 | 911583 | 911831 | - | NZ_CP015880.1 | Ensifer adhaerens |
| 42 | 1125158 | 1125433 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 43 | 2205985 | 2206233 | + | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 44 | 2878878 | 2879126 | + | NZ_CP054027.1 | Rhizobium hidalgonense |
| 45 | 1062770 | 1063018 | + | NZ_CP054021.1 | Rhizobium indicum |
| 46 | 1756634 | 1756882 | - | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 47 | 1284645 | 1284893 | - | NZ_LR723670.1 | Pseudorhizobium flavum |
| 48 | 1123213 | 1123461 | - | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 49 | 1750568 | 1750822 | + | NC_014313.1 | Hyphomicrobium denitrificans ATCC 51888 |
| 50 | 244713 | 244952 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 51 | 640794 | 641048 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 52 | 2254045 | 2254290 | + | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 53 | 1044526 | 1044762 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 54 | 2058365 | 2058640 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 55 | 2413825 | 2414079 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 56 | 2861580 | 2861828 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 57 | 3193412 | 3193660 | - | NZ_CP010803.1 | Martelella endophytica |
| 58 | 1599603 | 1599854 | - | NZ_CP041025.1 | Paremcibacter congregatus |
| 59 | 531393 | 531638 | - | NZ_CP071057.1 | Marinicauda algicola |
| 60 | 1269195 | 1269443 | + | NZ_CP010401.1 | Bartonella ancashensis |
| 61 | 3141972 | 3142205 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 62 | 139610 | 139894 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 63 | 52716 | 53003 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 64 | 1114632 | 1114916 | - | NC_013532.1 | Anaplasma centrale str. Israel |
| 65 | 830134 | 830406 | + | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 66 | 268331 | 268573 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 67 | 1041442 | 1041723 | - | NZ_CP041730.1 | Chitinimonas arctica |
| 68 | 96723 | 97013 | + | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 69 | 4068700 | 4068933 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 70 | 1054959 | 1055201 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 71 | 204279 | 204545 | + | NZ_CP047165.1 | Pelistega ratti |
| 72 | 1908769 | 1909014 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 73 | 2228967 | 2229212 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 74 | 789088 | 789354 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 75 | 5133380 | 5133613 | + | NZ_CP040336.1 | Bacillus luti |
| 76 | 5405331 | 5405564 | - | NC_011725.1 | Bacillus cereus B4264 |
| 77 | 3611401 | 3611658 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 78 | 5213716 | 5213949 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 79 | 3842574 | 3842807 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 80 | 735459 | 735704 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 81 | 3781074 | 3781310 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 82 | 1775719 | 1775964 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 83 | 360785 | 361030 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 84 | 1670534 | 1670773 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 85 | 1516066 | 1516305 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 86 | 884978 | 885217 | + | NZ_LR134293.1 | Streptococcus canis |
| 87 | 1997797 | 1998042 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 88 | 2381131 | 2381400 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 89 | 398804 | 399043 | + | NZ_LT906482.1 | Eikenella corrodens |
| 90 | 1706679 | 1706918 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 91 | 1635556 | 1635795 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 92 | 1681835 | 1682074 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 93 | 124103 | 124348 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 94 | 1730617 | 1730856 | - | NC_012924.1 | Streptococcus suis SC84 |
| 95 | 1576681 | 1576920 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 96 | 1643662 | 1643901 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 97 | 1332175 | 1332414 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 98 | 300640 | 300879 | + | NZ_LS483436.1 | Streptococcus intermedius |
| 99 | 1167930 | 1168169 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 100 | 1444751 | 1444990 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 101 | 1835572 | 1835811 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 102 | 443534 | 443773 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 103 | 1940542 | 1940781 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 104 | 417371 | 417616 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 105 | 10147 | 10389 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 106 | 2192383 | 2192652 | - | NZ_CP061800.1 | Desulfonema magnum |
| 107 | 1943842 | 1944078 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 108 | 2918040 | 2918312 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 109 | 1686159 | 1686437 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 110 | 3192050 | 3192328 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 111 | 1615919 | 1616179 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 112 | 701837 | 702148 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 113 | 24244 | 24510 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 114 | 1834499 | 1834774 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 115 | 13709 | 13984 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP004373.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03948.16 | 0.8 | 92 | 503.5 | same-strand | Ribosomal protein L9, C-terminal domain |
| 2 | PF01281.21 | 0.8 | 92 | 503.5 | same-strand | Ribosomal protein L9, N-terminal domain |
| 3 | PF01250.19 | 0.99 | 114 | 25.0 | same-strand | Ribosomal protein S6 |
++ More..