Result : Q5FRW6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000009.1 |
| Organism | Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) |
| Left | 1218923 |
| Right | 1219180 |
| Strand | - |
| Nucleotide Sequence | ATGGACGTTCAAGCCGCTCACGAATTCGGCATCAGCATCGCCCAGGCCGCCCGTGACCTCGGTGCCGGTATTGCCGTTTTCGCCCTCGCCGGTGTCGGCATGGGTCTCGGCAACATCTTCTCGACGCTGATCAGCTCGGTTGCACGCAACCCGGCCTCGCGTCCGCATGTCTTCGGCATCGGCATGCTGGGCTTCGCGCTGACGGAAGCCGTCGCGCTGTTCGCCCTGCTGATCGCCTTCCTGATCCTGTTCGCCTGA |
| Sequence | MDVQAAHEFGISIAQAARDLGAGIAVFALAGVGMGLGNIFSTLISSVARNPASRPHVFGIGMLGFALTEAVALFALLIAFLILFA |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 15665824 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | Q5FRW6 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1310894 | 1311151 | - | NZ_CP068419.1 | Gluconobacter sphaericus |
| 2 | 1336229 | 1336486 | - | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 3 | 2916541 | 2916798 | - | NZ_CP014689.1 | Gluconobacter albidus |
| 4 | 1273458 | 1273682 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 5 | 2559505 | 2559729 | - | NZ_CP042808.1 | Acetobacter oryzoeni |
| 6 | 1336230 | 1336454 | - | NC_021991.1 | Acetobacter pasteurianus 386B |
| 7 | 2774580 | 2774804 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 8 | 2856454 | 2856678 | - | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 9 | 1103410 | 1103634 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 10 | 1024170 | 1024394 | - | NZ_CP038141.1 | Swingsia samuiensis |
| 11 | 2392560 | 2392784 | - | NZ_CP014681.1 | Kozakia baliensis |
| 12 | 563826 | 564050 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 13 | 2064149 | 2064373 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 14 | 1993077 | 1993301 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 15 | 3166588 | 3166812 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 16 | 259736 | 259960 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 17 | 1877776 | 1878000 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 18 | 865050 | 865274 | + | NZ_CP032485.1 | Neokomagataea tanensis |
| 19 | 2930297 | 2930521 | - | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 20 | 567546 | 567770 | + | NZ_CP060244.1 | Entomobacter blattae |
| 21 | 710958 | 711182 | - | NZ_CP030265.1 | Skermanella pratensis |
| 22 | 1123229 | 1123453 | - | NZ_CP029353.1 | Azospirillum thermophilum |
| 23 | 145648 | 145872 | + | NZ_CP012401.1 | Azospirillum thiophilum |
| 24 | 2319467 | 2319691 | + | NZ_CP054619.1 | Azospirillum oryzae |
| 25 | 2128684 | 2128908 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 26 | 522019 | 522246 | - | NZ_CP029829.1 | Azospirillum ramasamyi |
| 27 | 4437455 | 4437679 | - | NZ_CP053708.1 | Lichenicola cladoniae |
| 28 | 824844 | 825068 | + | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 29 | 3081007 | 3081213 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 30 | 1733176 | 1733403 | - | NZ_CP030126.1 | Indioceanicola profundi |
| 31 | 3036980 | 3037204 | - | NZ_CP061205.1 | Kordiimonas pumila |
| 32 | 2398484 | 2398708 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 33 | 538229 | 538453 | + | NZ_CP024199.1 | Thalassospira marina |
| 34 | 4404672 | 4404896 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 35 | 440576 | 440800 | + | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 36 | 4161277 | 4161501 | - | NZ_CP031555.1 | Thalassospira indica |
| 37 | 1505786 | 1506010 | - | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 38 | 987334 | 987561 | + | NZ_CP014525.1 | Haematospirillum jordaniae |
| 39 | 258329 | 258556 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 40 | 3740053 | 3740259 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 41 | 874846 | 875085 | - | NZ_CP042906.1 | Hypericibacter terrae |
| 42 | 786113 | 786337 | + | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 43 | 1057530 | 1057754 | + | NZ_CP041025.1 | Paremcibacter congregatus |
| 44 | 2451390 | 2451614 | - | NZ_CP053923.1 | Defluviicoccus vanus |
| 45 | 5826242 | 5826466 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 46 | 5803151 | 5803375 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 47 | 5227675 | 5227899 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 48 | 1173556 | 1173780 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 49 | 349584 | 349808 | + | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP042808.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00430.20 | 1.0 | 49 | 419.5 | same-strand | ATP synthase B/B' CF(0) |
| 2 | PF00119.22 | 1.0 | 49 | 64 | same-strand | ATP synthase A chain |
| 3 | PF09527.12 | 0.98 | 48 | 835.5 | same-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
| 4 | PF02326.17 | 0.69 | 34 | 95.0 | same-strand | Plant ATP synthase F0 |
++ More..