Result : Q5FRJ4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000009.1 |
| Organism | Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) |
| Left | 1351324 |
| Right | 1351578 |
| Strand | + |
| Nucleotide Sequence | ATGGGCAGCATGAGCCCCGTTCACTGGCTGATCCTGGCGGTCGTCCTGCTCGTCGTGTTTGGCGGCGGTGGCAAGATCAGCGGCCTGATGGGAGACTTCGCGAAGGGCATCAAGTCCTTCAAGAAGAACATGGCCGACGATGAATCCATGACCGCGACGGATGCCACGCAGGCTCCGGGTCACATCTCTCCGCCGAACCAGAATCCCGGCTACAGCCAGACGACCAGCAGCGAAACGCACCGCAACCAGGTCTGA |
| Sequence | MGSMSPVHWLILAVVLLVVFGGGGKISGLMGDFAKGIKSFKKNMADDESMTATDATQAPGHISPPNQNPGYSQTTSSETHRNQV |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 15665824 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q5FRJ4 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 20
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1502231 | 1502485 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 2 | 1425190 | 1425444 | + | NZ_CP068419.1 | Gluconobacter sphaericus |
| 3 | 3024163 | 3024417 | + | NZ_CP014689.1 | Gluconobacter albidus |
| 4 | 1370580 | 1370837 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
| 5 | 803588 | 803854 | - | NZ_CP038141.1 | Swingsia samuiensis |
| 6 | 682511 | 682768 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 7 | 3193433 | 3193663 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 8 | 1587958 | 1588203 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 9 | 701833 | 702090 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 10 | 2300460 | 2300717 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 11 | 333846 | 334103 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 12 | 800524 | 800781 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 13 | 1401333 | 1401578 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 14 | 2686273 | 2686518 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 15 | 1458889 | 1459134 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 16 | 2456291 | 2456533 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 17 | 2112686 | 2112916 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 18 | 2813377 | 2813607 | - | NC_014006.1 | Sphingobium japonicum UT26S |
| 19 | 2097181 | 2097432 | + | NZ_CP022745.1 | Sphingobium xenophagum |
| 20 | 2848183 | 2848395 | - | NZ_CP032509.1 | Georhizobium profundi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP004373.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00185.26 | 0.65 | 13 | 2822 | opposite-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
| 2 | PF02729.23 | 0.65 | 13 | 2822 | opposite-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
| 3 | PF00202.23 | 0.65 | 13 | 1623 | opposite-strand | Aminotransferase class-III |
| 4 | PF02631.18 | 0.65 | 13 | 584 | same-strand | RecX family |
| 5 | PF05257.18 | 0.65 | 13 | 129 | same-strand | CHAP domain |
| 6 | PF00596.23 | 0.7 | 14 | 29.0 | same-strand | Class II Aldolase and Adducin N-terminal domain |
| 7 | PF03079.16 | 0.7 | 14 | 651.0 | same-strand | ARD/ARD' family |
| 8 | PF06574.14 | 0.7 | 14 | 1919.0 | same-strand | FAD synthetase |
| 9 | PF01687.19 | 0.7 | 14 | 1919.0 | same-strand | Riboflavin kinase |
++ More..