Result : Q5FJL5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein LBA1279 |
| NCBI Accession ID | CP000033.3 |
| Organism | Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) |
| Left | 1258961 |
| Right | 1259221 |
| Strand | - |
| Nucleotide Sequence | ATGAATAAAGATGCAATGAGTAAAGAAGAAAAGAAAGTTACAGATCGTATTAACGAACTTTATCATAAGAAAGAAAATGAAGGCTTAACTCCTGAAGAAGAAGAGGAACGTAAGGAATTACATAAGAAGTTCCTTGCTAACTTTAGAGCAGCATTTAAGCAAGATGTTGAAAATATGGTAATTCTTGATAAGAATGGTAAAGAAGTAACTTCTGAAAAGGCTAAGCAAGCTCAAAGAAAAAAGGGTCTTAGAAAAGATTAG |
| Sequence | MNKDAMSKEEKKVTDRINELYHKKENEGLTPEEEEERKELHKKFLANFRAAFKQDVENMVILDKNGKEVTSEKAKQAQRKKGLRKD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional |
| Pubmed ID | 15671160 |
| Domain | CDD:413030 |
| Functional Category | Others |
| Uniprot ID | Q5FJL5 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1258538 | 1258798 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 2 | 1045538 | 1045801 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 3 | 894492 | 894755 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 4 | 850132 | 850380 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 5 | 549296 | 549544 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 6 | 772729 | 772977 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 7 | 952843 | 953115 | - | NZ_CP029476.1 | Lactobacillus apis |
| 8 | 687367 | 687591 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 9 | 1103783 | 1104031 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 10 | 1191208 | 1191456 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 11 | 1155608 | 1155844 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 12 | 767571 | 767819 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 13 | 754548 | 754796 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 14 | 773791 | 774039 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 15 | 725918 | 726169 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 16 | 97667 | 97915 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 17 | 1215369 | 1215590 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 18 | 1552794 | 1553033 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 19 | 2106916 | 2107176 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 20 | 1501195 | 1501419 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 21 | 127964 | 128206 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 22 | 754269 | 754490 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 23 | 1023228 | 1023449 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 24 | 1102628 | 1102879 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 25 | 722146 | 722397 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 26 | 1757946 | 1758188 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 27 | 867429 | 867683 | - | NZ_CP017326.1 | Weissella soli |
| 28 | 922721 | 922975 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 29 | 2117234 | 2117488 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 30 | 933640 | 933873 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 31 | 884746 | 884970 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 32 | 2620111 | 2620344 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 33 | 1659676 | 1659918 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 34 | 1393234 | 1393467 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 35 | 1434475 | 1434717 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 36 | 649954 | 650196 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 37 | 872799 | 873032 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 38 | 702942 | 703178 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 39 | 577685 | 577939 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 40 | 859919 | 860155 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 41 | 576841 | 577092 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 42 | 1001090 | 1001320 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 43 | 1786010 | 1786243 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 44 | 960315 | 960566 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 45 | 1089131 | 1089367 | - | NZ_CP061835.1 | Weissella viridescens |
| 46 | 1357027 | 1357260 | - | NZ_CP027563.1 | Weissella confusa |
| 47 | 1935819 | 1936079 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 48 | 850574 | 850807 | + | NZ_CP014332.1 | Weissella jogaejeotgali |
| 49 | 830408 | 830659 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 50 | 882162 | 882395 | - | NZ_CP023501.1 | Weissella paramesenteroides |
| 51 | 708797 | 709048 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 52 | 465357 | 465596 | - | NZ_CP037940.1 | Weissella cryptocerci |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP018809.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03672.15 | 1.0 | 52 | 73.0 | same-strand | Uncharacterised protein family (UPF0154) |
| 2 | PF00717.25 | 0.96 | 50 | 149.0 | opposite-strand | Peptidase S24-like |
| 3 | PF01726.18 | 1.0 | 52 | 149.0 | opposite-strand | LexA DNA binding domain |
| 4 | PF01553.23 | 0.62 | 32 | 406.5 | opposite-strand | Acyltransferase |
++ More..