Result : Q5FA49
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | AE004969.1 |
| Organism | Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) |
| Left | 185216 |
| Right | 185419 |
| Strand | - |
| Nucleotide Sequence | ATGGGCAGTTTTTCTCTGACGCACTGGATTATCGTACTGATTATCGTCGTTTTGATATTCGGCACCAAAAAATTGCGCAACGTCGGCAAAGACCTCGGCGGTGCGGTTCATGACTTCAAACAGGGGCTGAACGAAGGCACAGACGGCAAAGAAGCCCAAAAAGACGATGTAATCGAACACAAAAAAGACGAAGACAAAGCATAA |
| Sequence | MGSFSLTHWIIVLIIVVLIFGTKKLRNVGKDLGGAVHDFKQGLNEGTDGKEAQKDDVIEHKKDEDKA |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q5FA49 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 67
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 258021 | 258224 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 2 | 1437002 | 1437205 | - | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 3 | 251010 | 251213 | - | NZ_LS483369.1 | Neisseria cinerea |
| 4 | 1569241 | 1569444 | - | NZ_CP031325.1 | Neisseria polysaccharea |
| 5 | 138592 | 138795 | + | NZ_CP039887.1 | Neisseria subflava |
| 6 | 1355444 | 1355647 | - | NZ_CP039886.1 | Neisseria flavescens |
| 7 | 320701 | 320904 | - | NZ_CP031253.1 | Neisseria lactamica |
| 8 | 1494790 | 1494984 | - | NZ_CP072524.1 | Neisseria sicca |
| 9 | 286918 | 287127 | + | NZ_CP059564.1 | Alysiella filiformis |
| 10 | 663570 | 663770 | + | NZ_CP031699.1 | Neisseria animalis |
| 11 | 490978 | 491181 | + | NZ_CP060414.1 | Neisseria musculi |
| 12 | 1700410 | 1700610 | - | NZ_CP022278.1 | Neisseria chenwenguii |
| 13 | 869446 | 869646 | + | NZ_CP059569.1 | Kingella oralis |
| 14 | 1550503 | 1550703 | - | NZ_LR134533.1 | Neisseria weaveri |
| 15 | 1432753 | 1432953 | + | NZ_LR134516.1 | Neisseria animaloris |
| 16 | 207426 | 207635 | - | NZ_LR134313.1 | Neisseria canis |
| 17 | 1598568 | 1598765 | - | NZ_CP031700.1 | Neisseria zalophi |
| 18 | 1678552 | 1678752 | - | NZ_LT906434.1 | Neisseria zoodegmatis |
| 19 | 530820 | 531017 | + | NZ_CP046027.1 | Neisseria brasiliensis |
| 20 | 319457 | 319666 | - | NZ_CP059565.1 | Neisseria wadsworthii |
| 21 | 1918051 | 1918251 | - | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 22 | 898621 | 898827 | - | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 23 | 4411668 | 4411910 | - | NZ_CP019236.1 | Rhodoferax koreense |
| 24 | 3110056 | 3110286 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 25 | 98674 | 98904 | + | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
| 26 | 143362 | 143583 | - | NZ_CP016440.1 | Bordetella pseudohinzii |
| 27 | 1763217 | 1763438 | - | NZ_CP021395.1 | Bordetella hinzii |
| 28 | 139179 | 139412 | - | NZ_CP016172.1 | Bordetella flabilis |
| 29 | 2732540 | 2732767 | - | NZ_LR134302.1 | Achromobacter spanius |
| 30 | 3867193 | 3867420 | + | NC_018518.1 | Bordetella pertussis 18323 |
| 31 | 3923525 | 3923752 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 32 | 136175 | 136402 | - | NZ_LR134326.1 | Bordetella bronchiseptica |
| 33 | 109386 | 109607 | + | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
| 34 | 157471 | 157692 | - | NZ_CP043146.1 | Bordetella holmesii |
| 35 | 5979803 | 5980042 | - | NZ_CP017420.1 | Delftia tsuruhatensis |
| 36 | 832651 | 832860 | - | NZ_LT906482.1 | Eikenella corrodens |
| 37 | 1940678 | 1940887 | + | NZ_CP038018.1 | Eikenella exigua |
| 38 | 641492 | 641710 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 39 | 4746082 | 4746291 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 40 | 495100 | 495309 | + | NZ_CP013235.1 | Collimonas arenae |
| 41 | 1948583 | 1948792 | - | NZ_CP059567.1 | Neisseria shayeganii |
| 42 | 4651423 | 4651626 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 43 | 1940569 | 1940775 | + | NZ_CP031252.1 | Neisseria elongata |
| 44 | 4731134 | 4731337 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 45 | 2904553 | 2904783 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 46 | 103356 | 103568 | - | NZ_CP059563.1 | Conchiformibius steedae |
| 47 | 2071004 | 2071207 | - | NZ_CP058952.1 | Chitinibacter fontanus |
| 48 | 353050 | 353280 | + | NZ_AP018786.1 | Sutterella megalosphaeroides |
| 49 | 3901618 | 3901848 | + | NZ_CP014646.1 | Thauera humireducens |
| 50 | 1300552 | 1300758 | - | NZ_CP029495.1 | Chromobacterium phragmitis |
| 51 | 4777398 | 4777607 | - | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 52 | 1699128 | 1699364 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 53 | 874347 | 874550 | - | NZ_CP039731.1 | Aquitalea aquatilis |
| 54 | 2574960 | 2575148 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 55 | 3195466 | 3195699 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 56 | 109203 | 109406 | + | NZ_CP047241.1 | Aquitalea denitrificans |
| 57 | 1400706 | 1400936 | + | NZ_CP014234.1 | Moraxella osloensis |
| 58 | 654866 | 655072 | + | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 59 | 2632233 | 2632439 | - | NZ_CP017707.1 | Chromobacterium vaccinii |
| 60 | 177465 | 177686 | + | NZ_CP030241.1 | Moraxella bovis |
| 61 | 115530 | 115769 | - | NZ_CP046603.1 | Lysobacter soli |
| 62 | 1192249 | 1192476 | - | NZ_CP029210.1 | Aquabacterium olei |
| 63 | 4814742 | 4814936 | + | NZ_CP027860.1 | Ahniella affigens |
| 64 | 570461 | 570679 | + | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 65 | 2312214 | 2312378 | - | NZ_CP007445.1 | Gilliamella apicola |
| 66 | 3577195 | 3577431 | - | NZ_CP046904.1 | Massilia flava |
| 67 | 4471457 | 4471660 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 68 | 497975 | 498154 | - | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP039887.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00902.20 | 0.99 | 66 | 565.0 | same-strand | Sec-independent protein translocase protein (TatC) |
| 2 | PF01230.25 | 0.82 | 55 | 49 | same-strand | HIT domain |
| 3 | PF11969.10 | 0.82 | 55 | 49 | same-strand | Scavenger mRNA decapping enzyme C-term binding |
| 4 | PF01503.19 | 0.84 | 56 | 445.5 | same-strand | Phosphoribosyl-ATP pyrophosphohydrolase |
| 5 | PF01502.20 | 0.75 | 50 | 836.0 | same-strand | Phosphoribosyl-AMP cyclohydrolase |
++ More..