Result : Q5F924
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Primosomal replication protein N (Primosome protein PriB) |
| NCBI Accession ID | AE004969.1 |
| Organism | Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) |
| Left | 569732 |
| Right | 570034 |
| Strand | + |
| Nucleotide Sequence | TTGGGATTCACTAATCTTGTTTCGCTTGCCGCGCTGATTGAAAAGGCTTTCCCTATTCGATATACGCCTGCCGGAATCCCTGTTTTAGATATTATTTTAAAGCACGAATCGTGGCAGGAGGAAAATGGGCAGCAATGCCTTGTCCAATTGGAAATCCCCGCGCGGATTTTGGGTAGGCAGGCGGAAGAGTGGCAGTATCGGCAAGGCGACTGCGCAACAGTCGAAGGTTTTTTAGCTCAAAAAAGCAGACGTTCCCTGATGCCGATGCTCAGGATACAAAATATTAAAGAATATAAAGGTTAA |
| Sequence | MGFTNLVSLAALIEKAFPIRYTPAGIPVLDIILKHESWQEENGQQCLVQLEIPARILGRQAEEWQYRQGDCATVEGFLAQKSRRSLMPMLRIQNIKEYKG |
| Source of smORF | Swiss-Prot |
| Function | Stimulates the DNA unwinding activity of PriA helicase, which does not seem to require single-stranded DNA-binding by PriB. Activates DNA-dependent ATP hydrolysis catalyzed by PriA (Pubmed:21861872). Has a weak single-stranded DNA-binding activity (Pubmed:21861872, Pubmed:19906704). Binds weakly also double-stranded DNA, a partial duplex DNA with a 3' single-stranded DNA overhang, and a forked DNA structure with fully duplex leading and lagging strand arms in vitro (Pubmed:21861872). {ECO:0000269|Pubmed:19906704, ECO:0000269|Pubmed:21861872}. |
| Pubmed ID | 21861872 19906704 |
| Domain | CDD:415809 |
| Functional Category | DNA-binding |
| Uniprot ID | Q5F924 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 119931 | 120233 | - | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 2 | 908731 | 909033 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 3 | 614228 | 614530 | + | NZ_LS483369.1 | Neisseria cinerea |
| 4 | 203621 | 203923 | - | NZ_CP031325.1 | Neisseria polysaccharea |
| 5 | 997202 | 997504 | - | NZ_CP031253.1 | Neisseria lactamica |
| 6 | 1721705 | 1722001 | + | NZ_CP072524.1 | Neisseria sicca |
| 7 | 97565 | 97861 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 8 | 221896 | 222192 | + | NZ_CP039887.1 | Neisseria subflava |
| 9 | 160575 | 160871 | + | NZ_CP039886.1 | Neisseria flavescens |
| 10 | 1881822 | 1882118 | + | NZ_CP031699.1 | Neisseria animalis |
| 11 | 405379 | 405675 | - | NZ_CP022278.1 | Neisseria chenwenguii |
| 12 | 1346273 | 1346521 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 13 | 1724476 | 1724772 | + | NZ_LR134313.1 | Neisseria canis |
| 14 | 2133721 | 2134017 | + | NZ_LR134533.1 | Neisseria weaveri |
| 15 | 1705490 | 1705786 | - | NZ_CP031700.1 | Neisseria zalophi |
| 16 | 989360 | 989656 | - | NZ_CP060414.1 | Neisseria musculi |
| 17 | 1943534 | 1943782 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 18 | 2129232 | 2129528 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 19 | 1526650 | 1526898 | + | NZ_CP059564.1 | Alysiella filiformis |
| 20 | 791556 | 791852 | + | NZ_LR134516.1 | Neisseria animaloris |
| 21 | 1195067 | 1195363 | - | NZ_CP059569.1 | Kingella oralis |
| 22 | 2254068 | 2254364 | + | NZ_CP031252.1 | Neisseria elongata |
| 23 | 999704 | 1000000 | - | NZ_CP059571.1 | Neisseria bacilliformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012028.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03948.16 | 1.0 | 23 | 254 | same-strand | Ribosomal protein L9, C-terminal domain |
| 2 | PF01281.21 | 1.0 | 23 | 254 | same-strand | Ribosomal protein L9, N-terminal domain |
| 3 | PF01084.22 | 1.0 | 23 | 7 | same-strand | Ribosomal protein S18 |
| 4 | PF01250.19 | 1.0 | 23 | 3 | same-strand | Ribosomal protein S6 |
++ More..