Result : Q5F881
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin FitA (Trafficking protein A) |
| NCBI Accession ID | AF200716.1 |
| Organism | Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) |
| Left | 199 |
| Right | 435 |
| Strand | + |
| Nucleotide Sequence | ATGGCTTCTGTTGTGATTAGAAATTTATCCGAGGCCACGCACAACGCAATCAAATTCCGTGCGCGAGCCGCAGGGCGCAGTACCGAAGCAGAAATCCGCTTAATTTTGGATAACATCGCCAAAGCACAACAAACTGTACGTTTGGGGTCAATGTTGGCATCAATAGGGCAGGAAATCGGAGGTGTTGAGCTGGAAGACGTACGCGGTCGTAATACTGATAACGAGGTTTCTTTGTGA |
| Sequence | MASVVIRNLSEATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSMLASIGQEIGGVELEDVRGRNTDNEVSL |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Plays a role in the speed with which bacteria traverse human epithelial cells; disruption of the locus increases the speed of trafficking about 2-4-fold. Binds to its own promoter, binding affinity of the FitAB complex is 20-30-fold higher than FitA alone. No nuclease activity was observed for the FitAB complex, perhaps because FitA (the antitoxin) prevents metal binding and thus catalysis by FitB. {ECO:0000269|Pubmed:10639460}. |
| Pubmed ID | 10639460 16156663 16982615 |
| Domain | |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | Q5F881 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1973660 | 1973896 | + | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 2 | 1114421 | 1114657 | - | NZ_CP031253.1 | Neisseria lactamica |
| 3 | 294735 | 294974 | - | NZ_CP011808.2 | Pandoraea faecigallinarum |
| 4 | 3225097 | 3225336 | - | NZ_AP014946.1 | Variibacter gotjawalensis |
| 5 | 2395339 | 2395572 | + | NZ_CP019239.1 | Rhodoferax saidenbachensis |
| 6 | 1708400 | 1708639 | + | NZ_CP013341.1 | Nitrosomonas ureae |
| 7 | 554416 | 554646 | + | NZ_CP060414.1 | Neisseria musculi |
| 8 | 1912401 | 1912634 | + | NC_015677.1 | Ramlibacter tataouinensis TTB310 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012028.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.88 | 7 | -3 | same-strand | PIN domain |
++ More..