Result : Q5E4P9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000020.2 |
| Organism | Aliivibrio fischeri (strain ATCC 700601 / ES114) (Vibrio fischeri) |
| Left | 1662846 |
| Right | 1663118 |
| Strand | - |
| Nucleotide Sequence | ATGTCACAAAAATCGTATCTATTTAATGTAAAGGGAAAAGTACAGCGTGTAGGTTTTCGTTTTCATACCGCTCATAACGCGTTAAAACTTGGTTTAACTGGCTATGCACGTAATCAAGAAGATGGTTCTGTCGAAGTGTTAGTATGTGGCAGTAAAGATAAAATTAATCAATTTCTTGAATGGTTACAAGTTGGACCGCAATTAGCGAGAGTGGATTCAATAAAGCAAGAAGAGACACAATGGCAAGAATTAACGGATTTTAAAATGTATTAA |
| Sequence | MSQKSYLFNVKGKVQRVGFRFHTAHNALKLGLTGYARNQEDGSVEVLVCGSKDKINQFLEWLQVGPQLARVDSIKQEETQWQELTDFKMY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 15703294 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q5E4P9 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 38
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1804404 | 1804676 | - | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 2 | 2110982 | 2111254 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 3 | 1536496 | 1536768 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 4 | 769134 | 769406 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 5 | 1988795 | 1989067 | + | NC_013456.1 | Vibrio antiquarius |
| 6 | 2053301 | 2053573 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 7 | 1352773 | 1353045 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 8 | 480054 | 480332 | + | NZ_CP067057.1 | Rahnella aceris |
| 9 | 2935499 | 2935780 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 10 | 1348749 | 1349027 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 11 | 1814146 | 1814370 | - | NZ_LR699114.1 | Aquicella lusitana |
| 12 | 1824268 | 1824546 | + | NZ_CP046268.1 | Vibrio spartinae |
| 13 | 1026486 | 1026761 | + | NZ_CP035688.1 | Vibrio metoecus |
| 14 | 877914 | 878192 | + | NZ_CP028271.1 | Mixta intestinalis |
| 15 | 4531101 | 4531382 | + | NZ_CP033744.1 | Citrobacter freundii |
| 16 | 15590 | 15835 | + | NZ_CP021358.1 | Kushneria marisflavi |
| 17 | 2854790 | 2855071 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 18 | 2578162 | 2578386 | - | NZ_CP038254.1 | Legionella israelensis |
| 19 | 582774 | 583055 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 20 | 1985055 | 1985330 | + | NZ_CP040990.1 | Vibrio furnissii |
| 21 | 3648454 | 3648687 | + | NZ_CP026047.1 | Raoultella planticola |
| 22 | 550970 | 551251 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 23 | 1369900 | 1370175 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 24 | 3596288 | 3596521 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 25 | 1710380 | 1710658 | + | NZ_CP026377.1 | Mixta gaviniae |
| 26 | 3952425 | 3952688 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 27 | 1632580 | 1632858 | + | NZ_CP061511.1 | Mixta calida |
| 28 | 1888603 | 1888851 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 29 | 4219586 | 4219864 | - | NZ_CP019706.1 | Pantoea alhagi |
| 30 | 3928080 | 3928325 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 31 | 1913957 | 1914235 | + | NZ_LT906479.1 | Serratia ficaria |
| 32 | 3714454 | 3714717 | - | NZ_CP050508.1 | Raoultella terrigena |
| 33 | 3426334 | 3426588 | - | NZ_CP041247.1 | Raoultella electrica |
| 34 | 2677379 | 2677624 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 35 | 3196365 | 3196610 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 36 | 2728329 | 2728598 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 37 | 6087248 | 6087529 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 38 | 3836300 | 3836578 | - | NZ_CP023009.1 | Lonsdalea britannica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP070624.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04358.15 | 0.84 | 32 | 4.5 | opposite-strand | DsrC like protein |
| 2 | PF17785.3 | 0.82 | 31 | 1472 | opposite-strand | PUA-like domain |
| 3 | PF01027.22 | 0.82 | 31 | 454 | opposite-strand | Inhibitor of apoptosis-promoting Bax1 |
++ More..