Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | CP000814.1 |
Organism | Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) |
Left | 1124482 |
Right | 1124721 |
Strand | - |
Nucleotide Sequence | ATGGGTGGTTGGTCAAGTCCAAGTCATTGGTTGATTATTTTATTGATTGTTGTATTGCTTTTTGGAGCAAAAAAAATTCCAGAACTTGCAAAGGGTTTAGGCAAAGGTATTAAAACTTTTAAAGATGAAATGAATAATGATGATGAAGTAGCAAAAAATACTCAAAAAATAGAAGAAAACAAAAACACAACTAATAATACAAGTGCTGATGCAAGTATAGACAAAACAAAAAAAGCTTAA |
Sequence | MGGWSSPSHWLIILLIVVLLFGAKKIPELAKGLGKGIKTFKDEMNNDDEVAKNTQKIEENKNTTNNTSADASIDKTKKA |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 17873037 |
Domain | |
Functional Category | Others |
Uniprot ID | A8FMN2 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1103771 | 1104010 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
2 | 226515 | 226748 | + | NZ_CP031611.1 | Campylobacter hepaticus |
3 | 1536782 | 1536979 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
4 | 1555880 | 1556095 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
5 | 1418470 | 1418682 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
6 | 236586 | 236789 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
7 | 1424391 | 1424606 | - | NZ_CP059443.1 | Campylobacter fetus |
8 | 1496457 | 1496678 | - | NZ_CP012541.1 | Campylobacter concisus |
9 | 1579608 | 1579808 | - | NZ_AP022847.1 | Nitrosophilus alvini |
10 | 1665036 | 1665248 | - | NZ_AP022826.1 | Nitrosophilus labii |
11 | 190385 | 190627 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
12 | 385554 | 385778 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
13 | 309530 | 309754 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
14 | 451128 | 451358 | + | NZ_CP020478.1 | Campylobacter helveticus |
15 | 1194569 | 1194805 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
16 | 342179 | 342382 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
17 | 454057 | 454296 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
18 | 1501590 | 1501820 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
19 | 444901 | 445101 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
20 | 2255070 | 2255267 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05746.17 | 1.0 | 20 | 10.0 | same-strand | DALR anticodon binding domain |
2 | PF00750.21 | 1.0 | 20 | 10.0 | same-strand | tRNA synthetases class I (R) |
3 | PF03485.18 | 0.75 | 15 | 10 | same-strand | Arginyl tRNA synthetase N terminal domain |
4 | PF00625.23 | 1.0 | 20 | 49.5 | same-strand | Guanylate kinase |
5 | PF13238.8 | 0.85 | 17 | 44 | same-strand | AAA domain |
6 | PF01311.22 | 0.75 | 15 | 2222 | same-strand | Bacterial export proteins, family 1 |
7 | PF00005.29 | 0.75 | 15 | 2955 | same-strand | ABC transporter |