Result : Q57P89
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Stationary-phase-induced ribosome-associated protein (SRA) (30S ribosomal protein S22) |
| NCBI Accession ID | AE017220.1 |
| Organism | Salmonella choleraesuis (strain SC-B67) |
| Left | 1659313 |
| Right | 1659456 |
| Strand | + |
| Nucleotide Sequence | ATGAAATCGAACCGTCAGGCTCGTCATATACTTGGACTGGATTACAGAATTTCCAACCAGCGTAAGGTTGTTACTGAAGGCGACACCAGCAGCGTGGTGAATAACCCAACCGGCAGAAAGCGCCGCGCCGATAGCCAAAAGTAA |
| Sequence | MKSNRQARHILGLDYRISNQRKVVTEGDTSSVVNNPTGRKRRADSQK |
| Source of smORF | Swiss-Prot |
| Function | Although this protein associates with the 30S subunit of the ribosome it is not considered to be a bona fide ribosomal protein. {ECO:0000250}. |
| Pubmed ID | 15781495 |
| Domain | CDD:329170 |
| Functional Category | Others |
| Uniprot ID | Q57P89 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1645484 | 1645627 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4040533 | 4040676 | + | NZ_CP053416.1 | Salmonella bongori |
| 3 | 3787202 | 3787345 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 4 | 3160654 | 3160797 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 5 | 1471280 | 1471423 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 6 | 1652183 | 1652326 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 7 | 129547 | 129687 | + | NZ_CP033744.1 | Citrobacter freundii |
| 8 | 950281 | 950421 | + | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 2077206 | 2077343 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 10 | 1555826 | 1555963 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 11 | 524622 | 524759 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 12 | 2204115 | 2204252 | + | NZ_LR134340.1 | Escherichia marmotae |
| 13 | 4878685 | 4878825 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 1545575 | 1545712 | - | NZ_AP014857.1 | Escherichia albertii |
| 15 | 1061017 | 1061154 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 16 | 1632780 | 1632917 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 17 | 2420760 | 2420897 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 18 | 294686 | 294823 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 19 | 2640123 | 2640260 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 20 | 149953 | 150090 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 21 | 2373927 | 2374064 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 22 | 2375620 | 2375757 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 23 | 2382406 | 2382543 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 24 | 1190451 | 1190588 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 25 | 2417805 | 2417942 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 26 | 3510366 | 3510497 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 27 | 2379216 | 2379353 | + | NC_015968.1 | Enterobacter soli |
| 28 | 2276104 | 2276244 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 29 | 2290773 | 2290910 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 30 | 2666007 | 2666147 | + | NZ_CP041247.1 | Raoultella electrica |
| 31 | 4384331 | 4384471 | - | NZ_CP026047.1 | Raoultella planticola |
| 32 | 2881180 | 2881320 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 33 | 2997464 | 2997604 | + | NZ_CP050508.1 | Raoultella terrigena |
| 34 | 2481244 | 2481384 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 35 | 3117703 | 3117843 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 36 | 2423333 | 2423473 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 37 | 2512564 | 2512704 | - | NZ_CP054254.1 | Klebsiella variicola |
| 38 | 2814385 | 2814525 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 39 | 2933895 | 2934035 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 40 | 2427544 | 2427681 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 41 | 3162806 | 3162940 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 42 | 682813 | 682950 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 43 | 1847960 | 1848094 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 44 | 2732302 | 2732439 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 45 | 2402531 | 2402668 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 46 | 2441536 | 2441673 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 47 | 716289 | 716426 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 48 | 3515081 | 3515206 | + | NZ_CP040428.1 | Jejubacter calystegiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT556085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02566.21 | 0.7 | 33 | 1716.0 | opposite-strand | OsmC-like protein |
| 2 | PF03949.17 | 0.98 | 46 | 177 | same-strand | Malic enzyme, NAD binding domain |
| 3 | PF00390.21 | 0.98 | 46 | 177 | same-strand | Malic enzyme, N-terminal domain |
| 4 | PF00005.29 | 0.83 | 39 | 2206.5 | same-strand | ABC transporter |
++ More..