Result : Q57JR3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Surface composition regulator |
| NCBI Accession ID | AE017220.1 |
| Organism | Salmonella choleraesuis (strain SC-B67) |
| Left | 3321390 |
| Right | 3321593 |
| Strand | - |
| Nucleotide Sequence | ATGAACAACAATAACGTCTATTCATTAAATAATTTCGATTTTCTGGCGCGCAGTTTTGCCAGAATGCAGGCGGAGGGGCGTCCTGTTGATATCCAGGCGGTAACCGGCAATATGGACGAGGAGCATCGCGACTGGTTTTGCAAGCGTTACGCGCTTTACTGCCAGCAGGCGACTCAGGCGAAAAGGTTAGAATTAGAACACTAA |
| Sequence | MNNNNVYSLNNFDFLARSFARMQAEGRPVDIQAVTGNMDEEHRDWFCKRYALYCQQATQAKRLELEH |
| Source of smORF | Swiss-Prot |
| Function | Major determinant of cell surface composition. Negatively regulates motility, adhesion and synthesis of biofilm exopolysaccharides. {ECO:0000255|HAMAP-Rule:MF_00525}. |
| Pubmed ID | 15781495 |
| Domain | CDD:420087 |
| Functional Category | Others |
| Uniprot ID | Q57JR3 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3359321 | 3359524 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4107469 | 4107672 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 3 | 4126214 | 4126402 | + | NZ_CP038469.1 | Citrobacter tructae |
| 4 | 3121894 | 3122082 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 5 | 1979489 | 1979668 | - | NZ_CP033744.1 | Citrobacter freundii |
| 6 | 1961092 | 1961271 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 5147641 | 5147820 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 3783337 | 3783516 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 1212161 | 1212364 | - | NZ_CP053416.1 | Salmonella bongori |
| 10 | 3191739 | 3191939 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 11 | 3181114 | 3181293 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 12 | 3711602 | 3711802 | - | NZ_LR134340.1 | Escherichia marmotae |
| 13 | 617430 | 617630 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 14 | 3931396 | 3931596 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 15 | 3182722 | 3182922 | - | NZ_AP014857.1 | Escherichia albertii |
| 16 | 4607906 | 4608103 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 17 | 564115 | 564324 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 18 | 710881 | 711078 | + | NZ_CP054254.1 | Klebsiella variicola |
| 19 | 686954 | 687151 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 20 | 673044 | 673241 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 21 | 710809 | 711018 | + | NZ_CP050508.1 | Raoultella terrigena |
| 22 | 3364627 | 3364824 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 23 | 762223 | 762432 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 24 | 692989 | 693198 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 25 | 643336 | 643545 | + | NZ_CP041247.1 | Raoultella electrica |
| 26 | 831613 | 831822 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 27 | 1028970 | 1029179 | - | NZ_CP026047.1 | Raoultella planticola |
| 28 | 2086324 | 2086524 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 29 | 2478700 | 2478906 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 30 | 3084950 | 3085150 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 31 | 103550 | 103753 | - | NZ_LS483470.1 | Leminorella richardii |
| 32 | 1471869 | 1472069 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 33 | 5255671 | 5255871 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 34 | 600256 | 600456 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 35 | 1199937 | 1200137 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 36 | 3968679 | 3968879 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 37 | 472766 | 472939 | + | NZ_LR134201.1 | Cedecea lapagei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00926.21 | 0.69 | 25 | 708 | same-strand | 3,4-dihydroxy-2-butanone 4-phosphate synthase |
| 2 | PF04380.15 | 0.72 | 26 | 35.0 | opposite-strand | Membrane fusogenic activity |
| 3 | PF00294.26 | 0.69 | 25 | 317.0 | same-strand | pfkB family carbohydrate kinase |
| 4 | PF03710.17 | 0.69 | 25 | 1803.5 | same-strand | Glutamate-ammonia ligase adenylyltransferase |
| 5 | PF08335.13 | 0.69 | 25 | 1803.5 | same-strand | GlnD PII-uridylyltransferase |
| 6 | PF01928.23 | 0.67 | 24 | 4801 | same-strand | CYTH domain |
++ More..