Result : Q57IG4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized lipoprotein YsaB |
| NCBI Accession ID | AE017220.1 |
| Organism | Salmonella choleraesuis (strain SC-B67) |
| Left | 3796537 |
| Right | 3796839 |
| Strand | - |
| Nucleotide Sequence | ATGATAATGAAGTATTTCTGTTCTGTGATGATAGCCATCGCTCTGGTGGGATGCACAGCGACACCGCCACCGACGCAAAAAGCCCAGCAGAGTAAAGTGAGCCCAACACGCACGCTGGATATGGAAGCATTGTGTAAAGCTCAGGCGGCGCAGCGTTACAATACTGGCGCACAGAAAATTGCTGTTACCGGTTTCGAACAGTTTCAGGGGAGCTATGAGATGCGGGGTAATACCTTCCGTAAAGAGAGTTTTGTCTGCTCTTTTGATGCAGATGGGCAGTTTTTACATCTTTCTATGCGGTAA |
| Sequence | MIMKYFCSVMIAIALVGCTATPPPTQKAQQSKVSPTRTLDMEALCKAQAAQRYNTGAQKIAVTGFEQFQGSYEMRGNTFRKESFVCSFDADGQFLHLSMR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13983. Profile Description: YsaB-like lipoprotein. This family of proteins is functionally uncharacterized. These proteins are related to E.coli YsaB. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length. These proteins are lipoproteins. |
| Pubmed ID | 15781495 |
| Domain | CDD:404804 |
| Functional Category | Others |
| Uniprot ID | Q57IG4 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 56
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3842911 | 3843213 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 1684784 | 1685086 | - | NZ_CP053416.1 | Salmonella bongori |
| 3 | 272361 | 272666 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 4 | 1401472 | 1401777 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 5 | 4478120 | 4478422 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 6 | 3597537 | 3597845 | + | NZ_CP038469.1 | Citrobacter tructae |
| 7 | 4606518 | 4606820 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 2585389 | 2585697 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 9 | 2474349 | 2474657 | - | NZ_CP033744.1 | Citrobacter freundii |
| 10 | 3694881 | 3695180 | - | NZ_AP014857.1 | Escherichia albertii |
| 11 | 3915366 | 3915665 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 12 | 4471708 | 4472007 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 13 | 2646962 | 2647261 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 14 | 3678627 | 3678932 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 15 | 3707075 | 3707374 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 16 | 3725413 | 3725712 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 17 | 4220507 | 4220803 | - | NZ_LR134340.1 | Escherichia marmotae |
| 18 | 4422130 | 4422432 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 19 | 3355311 | 3355616 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 20 | 189940 | 190245 | + | NC_015968.1 | Enterobacter soli |
| 21 | 542017 | 542322 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 22 | 198625 | 198930 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 23 | 179910 | 180215 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 24 | 2419526 | 2419831 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 25 | 168567 | 168872 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 26 | 211857 | 212162 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 27 | 139939 | 140241 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 28 | 3410728 | 3411033 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 29 | 183690 | 183995 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 30 | 2682690 | 2682995 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 31 | 4620781 | 4621032 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 32 | 180686 | 180991 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 33 | 661787 | 662092 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 34 | 5157397 | 5157675 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 35 | 4845078 | 4845383 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 36 | 159298 | 159576 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 37 | 3300128 | 3300406 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 38 | 4108503 | 4108781 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 39 | 179913 | 180218 | + | NZ_CP050508.1 | Raoultella terrigena |
| 40 | 251821 | 252126 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 41 | 3952566 | 3952844 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 42 | 4704660 | 4704932 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 43 | 1518854 | 1519126 | - | NZ_CP026047.1 | Raoultella planticola |
| 44 | 203848 | 204120 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 45 | 224048 | 224293 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 46 | 4289913 | 4290212 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 47 | 2959580 | 2959852 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 48 | 4196713 | 4197012 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 49 | 245247 | 245552 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 50 | 4215519 | 4215818 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 51 | 197355 | 197657 | + | NZ_CP054254.1 | Klebsiella variicola |
| 52 | 183004 | 183306 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 53 | 3576214 | 3576492 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 54 | 187305 | 187610 | + | NZ_CP041247.1 | Raoultella electrica |
| 55 | 1839250 | 1839531 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 56 | 5103560 | 5103832 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 57 | 130809 | 131120 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02092.19 | 1.0 | 56 | 1058 | same-strand | Glycyl-tRNA synthetase beta subunit |
| 2 | PF05746.17 | 1.0 | 56 | 1058 | same-strand | DALR anticodon binding domain |
| 3 | PF02091.17 | 1.0 | 56 | 137 | same-strand | Glycyl-tRNA synthetase alpha subunit |
| 4 | PF01757.24 | 1.0 | 56 | 183 | opposite-strand | Acyltransferase family |
| 5 | PF00370.23 | 0.95 | 53 | 2224.0 | same-strand | FGGY family of carbohydrate kinases, N-terminal domain |
| 6 | PF02782.18 | 0.95 | 53 | 2224.0 | same-strand | FGGY family of carbohydrate kinases, C-terminal domain |
++ More..