Protein Information |
Information Type | Description |
---|---|
Protein name | TrfB transcriptional repressor protein (Regulatory protein KorA) |
NCBI Accession ID | U67194.4 |
Organism | Escherichia coli |
Left | 4381 |
Right | 4683 |
Strand | - |
Nucleotide Sequence | ATGAAGAAACGGCTAACCGAAGCCCAATTCCAGACGGCCATCAAGGGGCTGGAGATCGGGCAGCAGACCATCGACATAGCGCGCGGCGTGCTGGTCGATGGCCGGCCCCAGGCGGAGTTTGTCACTTCGCTGGGGCTGACCAAGGGGGCGGTGTCGCAGGCGGTCAGTCGCGTATGGGCAGCAGCAGGGGAACAGCTCCCCGAGGGCTTCGAGCGAGTGACGGCGGTACTGCCGGAGCATCAAGCGTTCATCGTCAAGAAGTGGGAAGCAGACGCCAAGAGGAAACAGGAACCCAAGTCATGA |
Sequence | MKKRLTEAQFQTAIKGLEIGQQTIDIARGVLVDGRPQAEFVTSLGLTKGAVSQAVSRVWAAAGEQLPEGFERVTAVLPEHQAFIVKKWEADAKRKQEPKS |
Source of smORF | Swiss-Prot |
Function | In conjunction with KorB, inhibits the transcription of kilA, trfA and korAB operons. In conjunction with KorC is responsible for the negative control of kilC and kilE operons. |
Pubmed ID | 7773415 |
Domain | CDD:374591 |
Functional Category | DNA-binding |
Uniprot ID | Q57423 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 30228 | 30530 | + | NZ_CP019238.1 | Rhodoferax koreense |
2 | 22109 | 22417 | - | NZ_CP062809.1 | Cupriavidus basilensis |
3 | 50172 | 50474 | - | NZ_CP028340.1 | Thauera aromatica K172 |
4 | 4294217 | 4294522 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
5 | 36708 | 37016 | + | NZ_CP043477.1 | Xanthomonas hyacinthi |
6 | 142253 | 142558 | - | NC_006824.1 | Aromatoleum aromaticum EbN1 |
7 | 46144 | 46440 | - | NC_017858.1 | Methylophaga frappieri |
8 | 7170 | 7466 | + | NC_017508.1 | Marinobacter adhaerens HP15 |
9 | 27584 | 27889 | - | NC_016108.1 | Methylotuvimicrobium alcaliphilum 20Z |
10 | 35110 | 35415 | - | NZ_CP013482.1 | Pandoraea apista |
11 | 635344 | 635640 | - | NZ_CP054841.1 | Acidovorax antarcticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17394.4 | 0.82 | 9 | 197 | same-strand | Uncharacterized KleE stable inheritance protein |
2 | PF13614.8 | 0.91 | 10 | -3.0 | same-strand | AAA domain |
3 | PF01656.25 | 0.91 | 10 | -3.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
4 | PF06613.13 | 1.0 | 11 | 758 | same-strand | KorB C-terminal beta-barrel domain |
5 | PF02195.20 | 1.0 | 11 | 758 | same-strand | ParB-like nuclease domain |
6 | PF08535.12 | 0.91 | 10 | 758.0 | same-strand | KorB domain |
7 | PF11740.10 | 0.82 | 9 | 1999 | same-strand | Plasmid replication region DNA-binding N-term |
8 | PF18790.3 | 0.64 | 7 | 3196 | same-strand | KfrB protein |