Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_0555 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 575870 |
Right | 576109 |
Strand | - |
Nucleotide Sequence | ATGGAAATTTTAGCCTATATTTTAACTGCACTTGTCACCCTTGAACATTTCTACATTCTCTATTTAGAAATGTTCACCATTGAAAGCAAAAGTGGTGTTCGCCAATCAAGGGTTATACAACGGCTTTTTGGTAGCAGGGATTATTTTTGGTTATGCCATCAACCAAATTTCGGTGATTTATTTCTTTTTAGGTTGTGTGATTATCGCCGCAGTTTTTGGGGCAGTTACGACGAAGAATAA |
Sequence | MEILAYILTALVTLEHFYILYLEMFTIESKSGVRQSRVIQRLFGSRDYFWLCHQPNFGDLFLFRLCDYRRSFWGSYDEE |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 7542800 |
Domain | |
Functional Category | Others |
Uniprot ID | Q57409 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 540529 | 540768 | + | NZ_LS483429.1 | Haemophilus aegyptius |
2 | 469068 | 469307 | + | NZ_CP009610.1 | Haemophilus influenzae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03169.17 | 1.0 | 2 | 3626.0 | same-strand | OPT oligopeptide transporter protein |
2 | PF00459.27 | 1.0 | 2 | 2341.0 | same-strand | Inositol monophosphatase family |
3 | PF02781.18 | 1.0 | 2 | 781.0 | same-strand | Glucose-6-phosphate dehydrogenase, C-terminal domain |
4 | PF00479.24 | 1.0 | 2 | 781.0 | same-strand | Glucose-6-phosphate dehydrogenase, NAD binding domain |
5 | PF01182.22 | 1.0 | 2 | 0.0 | same-strand | Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase |
6 | PF00393.21 | 1.0 | 2 | 928.0 | same-strand | 6-phosphogluconate dehydrogenase, C-terminal domain |
7 | PF03446.17 | 1.0 | 2 | 928.0 | same-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
8 | PF10786.11 | 1.0 | 2 | 2508.0 | opposite-strand | Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49) |
9 | PF01755.19 | 1.0 | 2 | 4092.0 | same-strand | Glycosyltransferase family 25 (LPS biosynthesis protein) |