Result : Q57409
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0555 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 575870 |
| Right | 576109 |
| Strand | - |
| Nucleotide Sequence | ATGGAAATTTTAGCCTATATTTTAACTGCACTTGTCACCCTTGAACATTTCTACATTCTCTATTTAGAAATGTTCACCATTGAAAGCAAAAGTGGTGTTCGCCAATCAAGGGTTATACAACGGCTTTTTGGTAGCAGGGATTATTTTTGGTTATGCCATCAACCAAATTTCGGTGATTTATTTCTTTTTAGGTTGTGTGATTATCGCCGCAGTTTTTGGGGCAGTTACGACGAAGAATAA |
| Sequence | MEILAYILTALVTLEHFYILYLEMFTIESKSGVRQSRVIQRLFGSRDYFWLCHQPNFGDLFLFRLCDYRRSFWGSYDEE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q57409 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 540529 | 540768 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 2 | 469068 | 469307 | + | NZ_CP009610.1 | Haemophilus influenzae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483429.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03169.17 | 1.0 | 2 | 3626.0 | same-strand | OPT oligopeptide transporter protein |
| 2 | PF00459.27 | 1.0 | 2 | 2341.0 | same-strand | Inositol monophosphatase family |
| 3 | PF02781.18 | 1.0 | 2 | 781.0 | same-strand | Glucose-6-phosphate dehydrogenase, C-terminal domain |
| 4 | PF00479.24 | 1.0 | 2 | 781.0 | same-strand | Glucose-6-phosphate dehydrogenase, NAD binding domain |
| 5 | PF01182.22 | 1.0 | 2 | 0.0 | same-strand | Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase |
| 6 | PF00393.21 | 1.0 | 2 | 928.0 | same-strand | 6-phosphogluconate dehydrogenase, C-terminal domain |
| 7 | PF03446.17 | 1.0 | 2 | 928.0 | same-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
| 8 | PF10786.11 | 1.0 | 2 | 2508.0 | opposite-strand | Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49) |
| 9 | PF01755.19 | 1.0 | 2 | 4092.0 | same-strand | Glycosyltransferase family 25 (LPS biosynthesis protein) |
++ More..