Result : Q57392

Protein Information

• Protein name: Uncharacterized protein HI_0414
• NCBI Accession ID: L42023.1
• Organism: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
• Left: 437224
• Right: 437436
• Strand: +
• Nucleotide Sequence: ATGCCAATAGGCGGAGATGTGAAGGCGGATCAGGAAACATCAGGTTCTAGAAGCATAAAACGCATTGGCTTTGGTTTTATTGGTGGTATTGGCTATGACATTACACCGAATATTACCTTAGACTTAGGTTATCGTTATAACGATTGGGGACGTTTAGAAAACGTGCGTTTTAAAACTCATGAAGCCTCTTTCGGAGTGCGTTACCGCTTTTAA
• Sequence: MPIGGDVKADQETSGSRSIKRIGFGFIGGIGYDITPNITLDLGYRYNDWGRLENVRFKTHEASFGVRYRF
• Source of smORF: Swiss-Prot
• Pubmed ID: 7542800
• Functional Category: Others
• Uniprot ID: Q57392
• ORF Length (Amino Acid): 70

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	607139	607351	-	NZ_CP009610.1	Haemophilus influenzae
2	681720	681932	-	NZ_LS483429.1	Haemophilus aegyptius
3	88844	89050	+	NZ_CP039886.1	Neisseria flavescens

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP009610.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01136.21	0.67	2	4069.0	same-strand	Peptidase family U32
2	PF16325.7	0.67	2	4069.0	same-strand	Peptidase family U32 C-terminal domain
3	PF07690.18	0.67	2	2596.0	same-strand	Major Facilitator Superfamily
4	PF02581.19	0.67	2	1932.0	same-strand	Thiamine monophosphate synthase
5	PF08543.14	0.67	2	1112.0	same-strand	Phosphomethylpyrimidine kinase
6	PF02110.17	0.67	2	328.0	same-strand	Hydroxyethylthiazole kinase family
7	PF10150.11	0.67	2	496.5	same-strand	Ribonuclease E/G family
8	PF12111.10	0.67	2	496.5	same-strand	Polyribonucleotide phosphorylase C terminal
9	PF00575.25	0.67	2	496.5	same-strand	S1 RNA binding domain
10	PF00849.24	0.67	2	3725.5	opposite-strand	RNA pseudouridylate synthase
11	PF01479.27	0.67	2	3725.5	opposite-strand	S4 domain
12	PF17209.5	0.67	2	4784.5	opposite-strand	Hfq protein
13	PF00158.28	0.67	2	5156.0	same-strand	Sigma-54 interaction domain
14	PF18024.3	0.67	2	5156.0	same-strand	Helix-turn-helix domain
15	PF14532.8	0.67	2	5156.0	same-strand	Sigma-54 interaction domain
16	PF19425.1	0.67	2	6227.0	same-strand	Csd3 second domain
17	PF01551.24	0.67	2	6227.0	same-strand	Peptidase family M23
18	PF04225.14	0.67	2	6227.0	same-strand	Opacity-associated protein A LysM-like domain