Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_1049 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1114948 |
Right | 1115241 |
Strand | + |
Nucleotide Sequence | GTGGCATCAACCTTGTGCTGCATCGCACCATTAATTTATTTAGTATTTGGTGTGTCGTCCACTTGGTTGATTGGCTTAGGCGAATATGATTATTTGCGTATTCCCATGCTTATTATTTCATTATGCGCCTTTGCCTATGGATTTTGGCTGTTGATGTTTTCCAAAAAAATCATTTGTAGCAAATATATTTCCCGTAAAAAACTCATCGTTTTATATTGGATTGTATTTATTGTGATGATTTTTTTCTTAACCTATCCAACAATTTTGCCTTGGATTTTAGAATTAGCTAATTAG |
Sequence | MASTLCCIAPLIYLVFGVSSTWLIGLGEYDYLRIPMLIISLCAFAYGFWLLMFSKKIICSKYISRKKLIVLYWIVFIVMIFFLTYPTILPWILELAN |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl03578. Profile Description: MerT mercuric transport protein. putative mercuric transport protein; Provisional |
Pubmed ID | 7542800 |
Domain | CDD:186578 |
Functional Category | Others |
Uniprot ID | Q57347 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1811091 | 1811384 | - | NZ_CP009610.1 | Haemophilus influenzae |
2 | 233170 | 233463 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
3 | 963263 | 963547 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
4 | 2241944 | 2242216 | - | NZ_LT906448.1 | Pasteurella dagmatis |
5 | 550602 | 550844 | + | NZ_CP028926.1 | Pasteurella multocida |
6 | 1887135 | 1887452 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
7 | 608157 | 608408 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
8 | 495144 | 495389 | + | NZ_CP046531.1 | Mannheimia ovis |
9 | 537666 | 537911 | + | NZ_CP055305.1 | Mannheimia pernigra |
10 | 2135613 | 2135855 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
11 | 82653 | 82913 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
12 | 398689 | 398988 | - | NZ_CP061280.1 | Mannheimia bovis |
13 | 1734782 | 1735024 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
14 | 1729045 | 1729287 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
15 | 2193979 | 2194272 | - | NZ_CP015031.1 | Basfia succiniciproducens |
16 | 320477 | 320770 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
17 | 98926 | 99225 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
18 | 930005 | 930289 | + | NZ_CP015029.1 | Frederiksenia canicola |
19 | 236713 | 237006 | + | NZ_LR134167.1 | Avibacterium volantium |
20 | 651229 | 651543 | - | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
21 | 4197968 | 4198270 | + | NZ_CP040428.1 | Jejubacter calystegiae |
22 | 3055411 | 3055737 | + | NZ_LS483470.1 | Leminorella richardii |
23 | 3732593 | 3732835 | - | NC_016901.1 | Shewanella baltica OS678 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00403.28 | 1.0 | 23 | 1 | same-strand | Heavy-metal-associated domain |
2 | PF01841.21 | 1.0 | 23 | 44 | same-strand | Transglutaminase-like superfamily |