Result : Q57300
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Colicin-E5 immunity protein in ColE9 (E5Imm[E9]) |
| NCBI Accession ID | X15858.1 |
| Organism | Escherichia coli |
| Left | 1423 |
| Right | 1674 |
| Strand | + |
| Nucleotide Sequence | ATGAAGTTATCACCAAAAGCTGCAATAGAAGTTTGTAATGAAGCAGCGAAAAAAGGCTTATGGATTTTGGGCATTGATGGTGGGCATTGGCTGAATCCTGGATTCAGGATAGATAGTTCAGCATCATGGACATATGATATGCCGGAGGAATACAAATCAAAAACCCCTGAAAATAATAGATTGGCTATTGAAAATATTAAAGATGATATTGAGAATGGATACACTGCTTTCATTATCACGTTAAAGATGTAA |
| Sequence | MKLSPKAAIEVCNEAAKKGLWILGIDGGHWLNPGFRIDSSASWTYDMPEEYKSKTPENNRLAIENIKDDIENGYTAFIITLKM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11480. Profile Description: Colicin-E5 Imm protein. Imms bind specifically to cognate colicins in order to protect their host cells. Imm-E5 is a specific inhibitor protein of colicin E5. It binds to E5 C-terminal ribonuclease domain (CRD) to prevent cell death. The binding mode of E5-CRD and Imm-E5 mimics that of mRNA and tRNA suggesting an evolutionary pathway from the RNA-RNA interaction through the RNA-protein interaction of tRNA/E5-CRD. |
| Pubmed ID | 2549375 3312476 |
| Domain | CDD:288352 |
| Functional Category | Others |
| Uniprot ID | Q57300 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4084791 | 4085051 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 2 | 2054551 | 2054805 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 3 | 3216287 | 3216541 | + | NZ_CP026364.1 | Proteus hauseri |
| 4 | 2844229 | 2844489 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 5 | 2044859 | 2045110 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048784.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12106.10 | 0.8 | 4 | 78.0 | same-strand | Colicin E5 ribonuclease domain |
++ More..