Result : Q56348
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein NapE |
| NCBI Accession ID | Z36773.1 |
| Organism | Paracoccus pantotrophus (Thiosphaera pantotropha) |
| Left | 1034 |
| Right | 1213 |
| Strand | + |
| Nucleotide Sequence | ATGATCGATTCCGCGAAAGAAACCGATCGTCCCAAGCACCGCAAGCGGGATGAAGTCATCGCCTTCCTGATCCTTGCCGTGGTGATCTGGCCGATCCTGTCGGTCGCGATCGTCGGCGGCTACGGCTTCCTGGTCTGGATGTCTCAGATCATCTTCGGACCCCCCGGACCCATGCATTAG |
| Sequence | MIDSAKETDRPKHRKRDEVIAFLILAVVIWPILSVAIVGGYGFLVWMSQIIFGPPGPMH |
| Source of smORF | Swiss-Prot |
| Function | May be involved in mediating interactions between NapC and a quinol oxidase. |
| Pubmed ID | 7639719 |
| Domain | CDD:382737 |
| Functional Category | Others |
| Uniprot ID | Q56348 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 43750 | 43896 | - | NZ_CP030128.1 | Indioceanicola profundi |
| 2 | 1349189 | 1349374 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 3 | 2049747 | 2049935 | - | NZ_CP015880.1 | Ensifer adhaerens |
| 4 | 979924 | 980121 | - | NC_007964.1 | Nitrobacter hamburgensis X14 |
| 5 | 3087109 | 3087270 | + | NZ_CP017689.1 | Thalassotalea crassostreae |
| 6 | 1721701 | 1721865 | + | NZ_CP048812.1 | Halomonas socia |
| 7 | 1085039 | 1085200 | - | NC_003910.7 | Colwellia psychrerythraea 34H |
| 8 | 2580077 | 2580232 | - | NZ_CP037951.1 | Parashewanella tropica |
| 9 | 2063404 | 2063580 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 10 | 15319 | 15474 | - | NZ_CP014055.2 | Grimontia hollisae |
| 11 | 1129684 | 1129869 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 12 | 1174868 | 1175041 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 13 | 1378309 | 1378491 | - | NZ_CP035688.1 | Vibrio metoecus |
| 14 | 2263493 | 2263660 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 15 | 3754237 | 3754386 | - | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 16 | 1949503 | 1949685 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 17 | 2187243 | 2187404 | + | NZ_CP042218.1 | Luteimonas granuli |
| 18 | 1238698 | 1238871 | + | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 19 | 3624789 | 3624980 | - | NZ_LR723670.1 | Pseudorhizobium flavum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030128.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03264.16 | 0.95 | 18 | 3746.5 | same-strand | NapC/NirT cytochrome c family, N-terminal region |
| 2 | PF03892.16 | 0.68 | 13 | 3287 | same-strand | Nitrate reductase cytochrome c-type subunit (NapB) |
| 3 | PF00384.24 | 0.95 | 18 | 789.5 | same-strand | Molybdopterin oxidoreductase |
| 4 | PF01568.23 | 0.95 | 18 | 789.5 | same-strand | Molydopterin dinucleotide binding domain |
| 5 | PF04879.18 | 0.68 | 13 | 778 | same-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 6 | PF03927.15 | 0.68 | 13 | 503 | same-strand | NapD protein |
++ More..