Result : Q56316
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Pyruvate synthase subunit PorD (Pyruvate oxidoreductase delta chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit delta) |
| NCBI Accession ID | X85171.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 2063 |
| Right | 2362 |
| Strand | + |
| Nucleotide Sequence | ATGTCTCTTAAAAGCTGGAAGGAAATTCCCATTGGAGGAGTCATCGACAAACCGGGAACAGCAAGAGAATACAAAACAGGTGCCTGGCGTGTGATGAGACCTATTCTTCACAAAGAGAAATGTATAGACTGTATGTTCTGCTGGCTCTACTGTCCAGATCAAGCGATCATCCAAGAAGGCGGAATAATGAAAGGTTTCAACTACGACTACTGTAAAGGATGCGGACTCTGTGCGAACGTATGTCCAAAGCAGGCCATAGAGATGAGACCTGAGACTGAGTTTCTGAGCGAGGAGGGATGA |
| Sequence | MSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam00037. Profile Description: 4Fe-4S binding domain. Superfamily includes proteins containing domains which bind to iron-sulfur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich.**The ORF matches to the profile of PRK09625. Profile Description: pyruvate flavodoxin oxidoreductase subunit delta; Reviewed**The ORF matches to the profile of TIGR02179. Profile Description: 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family. A number of anaerobic and microaerophilic species lack pyruvate dehydrogenase and have instead a four subunit, oxygen-sensitive pyruvate oxidoreductase, with either ferredoxins or flavodoxins used as the acceptor. Several related four-subunit enzymes may exist in the same species. This model describes a subfamily of delta subunits, representing mostly pyruvate, 2-ketoisovalerate, and 2-oxoglutarate specific enzymes. The delta subunit is the smallest and resembles ferredoxins.**The ORF matches to the profile of COG1146. Profile Description: NAD-dependent dihydropyrimidine dehydrogenase, PreA subunit [Nucleotide transport and metabolism]. |
| Pubmed ID | 8550425 10360571 |
| Domain | CDD:394993,CDD:236596,CDD:131234,CDD:224069 |
| Functional Category | Metal-binding |
| Uniprot ID | Q56316 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 64
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 665564 | 665863 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 2 | 929004 | 929303 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 3 | 931487 | 931786 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 4 | 685075 | 685374 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 1874917 | 1875177 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 6 | 1848651 | 1848953 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 7 | 969756 | 970058 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 8 | 1846747 | 1847040 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 9 | 1881886 | 1882179 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 10 | 1213529 | 1213822 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 11 | 397795 | 398091 | + | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 12 | 664398 | 664706 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 13 | 305451 | 305765 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 14 | 1633840 | 1634121 | + | NC_016751.1 | Marinitoga piezophila KA3 |
| 15 | 1255071 | 1255421 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 16 | 526635 | 526967 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 17 | 940666 | 941016 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 18 | 348438 | 348770 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 19 | 1285044 | 1285352 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 20 | 638351 | 638644 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 21 | 1455004 | 1455300 | + | NZ_CP009961.1 | Infirmifilum uzonense |
| 22 | 1515756 | 1516028 | + | NZ_CP007493.1 | Thermofilum adornatus 1505 |
| 23 | 2243457 | 2243789 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 24 | 897631 | 897930 | - | NZ_CP062310.1 | Infirmifilum lucidum |
| 25 | 48141 | 48422 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 26 | 2304118 | 2304426 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 27 | 3120318 | 3120635 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 28 | 1640585 | 1640833 | + | NC_009073.1 | Pyrobaculum calidifontis JCM 11548 |
| 29 | 521529 | 521801 | + | NC_008698.1 | Thermofilum pendens Hrk 5 |
| 30 | 37631 | 37885 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 31 | 1805622 | 1805912 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 32 | 699139 | 699429 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 33 | 1777222 | 1777530 | - | NC_016070.1 | Thermoproteus tenax Kra 1 |
| 34 | 1176700 | 1176972 | + | NC_017954.1 | Thermogladius calderae 1633 |
| 35 | 1336207 | 1336464 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 36 | 1174498 | 1174785 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 37 | 819642 | 819932 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 38 | 938477 | 938767 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 39 | 1839154 | 1839444 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 40 | 1941237 | 1941527 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 41 | 974347 | 974637 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 42 | 939501 | 939791 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 43 | 1412995 | 1413288 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 44 | 22456 | 22698 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 45 | 357278 | 357559 | - | NC_014160.1 | Thermosphaera aggregans DSM 11486 |
| 46 | 1420275 | 1420565 | + | NC_009033.1 | Staphylothermus marinus F1 |
| 47 | 961867 | 962157 | - | NC_014205.1 | Staphylothermus hellenicus DSM 12710 |
| 48 | 477454 | 477735 | - | NC_018001.1 | Desulfurococcus amylolyticus DSM 16532 |
| 49 | 93501 | 93797 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 50 | 536758 | 537000 | + | NC_009515.1 | Methanobrevibacter smithii ATCC 35061 |
| 51 | 422404 | 422676 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 52 | 18525 | 18833 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 53 | 2621890 | 2622198 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 54 | 267387 | 267665 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 55 | 367856 | 368116 | + | NC_014002.1 | Methanohalophilus mahii DSM 5219 |
| 56 | 1952362 | 1952640 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 57 | 1402335 | 1402577 | + | NZ_CP017768.1 | Methanobacterium subterraneum |
| 58 | 75485 | 75754 | + | NC_003551.1 | Methanopyrus kandleri AV19 |
| 59 | 484450 | 484719 | + | NC_009635.1 | Methanococcus aeolicus Nankai-3 |
| 60 | 353028 | 353288 | - | NZ_CP017921.1 | Methanohalophilus halophilus |
| 61 | 1877528 | 1877770 | + | NZ_LN734822.1 | Methanobacterium formicicum |
| 62 | 253095 | 253337 | + | NC_014658.1 | Methanothermus fervidus DSM 2088 |
| 63 | 2403119 | 2403379 | + | NC_019977.1 | Methanomethylovorans hollandica DSM 15978 |
| 64 | 2124745 | 2125005 | + | NC_015676.1 | Methanosalsum zhilinae DSM 4017 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013642.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01558.20 | 1.0 | 64 | 5 | same-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
| 2 | PF01855.21 | 1.0 | 64 | 13.0 | same-strand | Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg |
| 3 | PF17147.6 | 1.0 | 64 | 13 | same-strand | Pyruvate:ferredoxin oxidoreductase core domain II |
| 4 | PF02775.23 | 1.0 | 64 | 1206 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
++ More..