Result : Q56029

Protein Information

• Protein name: Virulence protein PagD
• NCBI Accession ID: U31849.1
• Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
• Left: 91
• Right: 354
• Strand: +
• Nucleotide Sequence: ATGAAACATCATGCTTTTATGCTTTGGTCATTACTTATTTTTTCATTCCATGTTTTGGCCAGTTCAGGCCATTGTTCTGGTTTACAACAGGCATCATGGGATATTTTTATCTACGATTTTGGTAGTAAAACCCCGCAACCACCTACAAATACTGATAAAAAGCAAGCCAGGCAGATTAGTTCACCGTCCTGCCCGACGACAAAACCCATGATGTCCGCACCAGTCAATGACGCCAGGAAAGGGAATACTTTCTCCAGAACATAA
• Sequence: MKHHAFMLWSLLIFSFHVLASSGHCSGLQQASWDIFIYDFGSKTPQPPTNTDKKQARQISSPSCPTTKPMMSAPVNDARKGNTFSRT
• Source of smORF: Swiss-Prot
• Function: Putative function in virulence. Could be involved in promoting S.typhimurium survival within macrophages.
• Pubmed ID: 7665482 11677609
• Functional Category: Others
• Uniprot ID: Q56029
• ORF Length (Amino Acid): 87

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1331166	1331429	-	NC_003197.2	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2	3736770	3737033	-	NZ_CP053416.1	Salmonella bongori

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_003197.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF06183.15	1.0	2	3125.5	same-strand	DinI-like family
2	PF00652.24	1.0	2	2407.0	same-strand	Ricin-type beta-trefoil lectin domain
3	PF06316.13	1.0	2	754.0	opposite-strand	Enterobacterial Ail/Lom protein
4	PF13505.8	1.0	2	754.0	opposite-strand	Outer membrane protein beta-barrel domain
5	PF09864.11	1.0	2	2525.0	same-strand	Membrane-bound lysozyme-inhibitor of c-type lysozyme