Protein Information |
Information Type | Description |
---|---|
Protein name | Virulence protein PagD |
NCBI Accession ID | U31849.1 |
Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
Left | 91 |
Right | 354 |
Strand | + |
Nucleotide Sequence | ATGAAACATCATGCTTTTATGCTTTGGTCATTACTTATTTTTTCATTCCATGTTTTGGCCAGTTCAGGCCATTGTTCTGGTTTACAACAGGCATCATGGGATATTTTTATCTACGATTTTGGTAGTAAAACCCCGCAACCACCTACAAATACTGATAAAAAGCAAGCCAGGCAGATTAGTTCACCGTCCTGCCCGACGACAAAACCCATGATGTCCGCACCAGTCAATGACGCCAGGAAAGGGAATACTTTCTCCAGAACATAA |
Sequence | MKHHAFMLWSLLIFSFHVLASSGHCSGLQQASWDIFIYDFGSKTPQPPTNTDKKQARQISSPSCPTTKPMMSAPVNDARKGNTFSRT |
Source of smORF | Swiss-Prot |
Function | Putative function in virulence. Could be involved in promoting S.typhimurium survival within macrophages. |
Pubmed ID | 7665482 11677609 |
Domain | |
Functional Category | Others |
Uniprot ID | Q56029 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1331166 | 1331429 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 3736770 | 3737033 | - | NZ_CP053416.1 | Salmonella bongori |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06183.15 | 1.0 | 2 | 3125.5 | same-strand | DinI-like family |
2 | PF00652.24 | 1.0 | 2 | 2407.0 | same-strand | Ricin-type beta-trefoil lectin domain |
3 | PF06316.13 | 1.0 | 2 | 754.0 | opposite-strand | Enterobacterial Ail/Lom protein |
4 | PF13505.8 | 1.0 | 2 | 754.0 | opposite-strand | Outer membrane protein beta-barrel domain |
5 | PF09864.11 | 1.0 | 2 | 2525.0 | same-strand | Membrane-bound lysozyme-inhibitor of c-type lysozyme |