Result : A8FB03
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0435 protein BPUM_0734 |
| NCBI Accession ID | CP000813.4 |
| Organism | Bacillus pumilus (strain SAFR-032) |
| Left | 818676 |
| Right | 818891 |
| Strand | - |
| Nucleotide Sequence | TTGTCAGAGCAAAAAGCGGCTGAAGTCAATCAGCTGATTGAAGACATTTCGCAAAAGTTAAATATGCTGAACATTGGAGTCATCAAAGCAGAGGACTTCAGTCCAGACAAGTACGAAGATATTGAATTTCTTCACCAAATGGTGATGAAAAAATCTTCATTCAGCCCAAGTGAAATGCAAGCCATCGCAAGCGAGCTAAAAAACTTAAGAAAATAA |
| Sequence | MSEQKAAEVNQLIEDISQKLNMLNIGVIKAEDFSPDKYEDIEFLHQMVMKKSSFSPSEMQAIASELKNLRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23968. Profile Description: Protein of unknown function (DUF1128). This family consists of several short, hypothetical bacterial proteins of unknown function. |
| Pubmed ID | 17895969 |
| Domain | CDD:420123 |
| Functional Category | Others |
| Uniprot ID | A8FB03 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 724038 | 724253 | + | NZ_CP043404.1 | Bacillus safensis |
| 2 | 773468 | 773683 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 3 | 845416 | 845634 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 4 | 837418 | 837633 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 5 | 920112 | 920327 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 6 | 3152705 | 3152887 | + | NZ_CP011937.1 | Bacillus velezensis |
| 7 | 799848 | 800030 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 890007 | 890222 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 9 | 860137 | 860352 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 1143329 | 1143544 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 11 | 861586 | 861801 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 12 | 1047852 | 1048067 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 13 | 795517 | 795732 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 14 | 838420 | 838635 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 15 | 838981 | 839196 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 16 | 361967 | 362155 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 17 | 3343486 | 3343668 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 18 | 856928 | 857122 | - | NZ_CP053989.1 | Niallia circulans |
| 19 | 806617 | 806799 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 20 | 2730068 | 2730253 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 21 | 773959 | 774141 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 22 | 324484 | 324672 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 23 | 923408 | 923590 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 24 | 1151858 | 1152043 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 25 | 953988 | 954170 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 26 | 1125683 | 1125868 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 27 | 1350674 | 1350895 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 28 | 1535558 | 1535743 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043404.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03631.17 | 0.93 | 26 | 1099.5 | opposite-strand | Virulence factor BrkB |
| 2 | PF01451.23 | 0.71 | 20 | 204.0 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
| 3 | PF01965.26 | 0.64 | 18 | 1359.0 | opposite-strand | DJ-1/PfpI family |
++ More..