Protein Information |
Information Type | Description |
---|---|
Protein name | CRISPR-associated endoribonuclease Cas2 (EC 3.1.-.-) |
NCBI Accession ID | AP008227.1 |
Organism | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) |
Left | 228477 |
Right | 228761 |
Strand | - |
Nucleotide Sequence | ATGAGGGAACTGTACCTGGTCATCGCCTACGATACCCCTGACGACCGTCGGCGGGCGCGGCTTGCCAAGCTGCTCAAGGGCTTTGGCGAAAGGCGGCAGTACTCCGTGTTTGAAGCCCGGTTGACCCGGGAGCAGTGGGCCCACCTCAAGGGCAAGCTGGAAGCCCTGGTCAACAAGGAGGAGGACGTTTTGGCGGTGTACTTCTTGCCCCCGGAGGCGGTGGGACGCACCTGGCGCATCGGCCACGAGGGGTTGAAGCGCCTCGAGGACCCCGACTTCGTCTAG |
Sequence | MRELYLVIAYDTPDDRRRARLAKLLKGFGERRQYSVFEARLTREQWAHLKGKLEALVNKEEDVLAVYFLPPEAVGRTWRIGHEGLKRLEDPDFV |
Source of smORF | Swiss-Prot |
Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette. {ECO:0000255|HAMAP-Rule:MF_01471}. |
Pubmed ID | |
Domain | CDD:416272 |
Functional Category | Metal-binding |
Uniprot ID | Q53VV6 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 228477 | 228761 | - | NC_006462.1 | Thermus thermophilus HB8 |
2 | 320099 | 320362 | - | NC_014213.1 | Meiothermus silvanus DSM 9946 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01867.18 | 1.0 | 2 | 12.5 | same-strand | CRISPR associated protein Cas1 |
2 | PF01930.19 | 1.0 | 2 | 986.5 | same-strand | Domain of unknown function DUF83 |
3 | PF13280.8 | 1.0 | 2 | 1837.0 | opposite-strand | WYL domain |