Result : Q53866
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein SCO3924 |
| NCBI Accession ID | AL939118.1 |
| Organism | Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Left | 91168 |
| Right | 91380 |
| Strand | + |
| Nucleotide Sequence | ATGCGAGAGATCTTCACGGGACTGCCGTGGTGGGTGAAGTGGATCGCGGTGCCGGTCATCGCCCTGGTCGTGTTCGGCGGACTGATCGTCAGCGTGGTCGGGTTCGTGGTCGGACTGCTGTTCAAGCTGCTGGTCTTCGTCGCGCTCGTCGGCGGACTGATTTATGTCGTACGCAAGTTCATGTCGAGCTCGTCGTCGCGCAGCGACTGGTGA |
| Sequence | MREIFTGLPWWVKWIAVPVIALVVFGGLIVSVVGFVVGLLFKLLVFVALVGGLIYVVRKFMSSSSSRSDW |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17260. Profile Description: Family of unknown function (DUF5326). This is a family of unknown function mostly found in Actinobacteria. Many of the family members are predicted to contain two trans-membrane domains. |
| Pubmed ID | 12000953 8550407 |
| Domain | CDD:407374 |
| Functional Category | Others |
| Uniprot ID | Q53866 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 86
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3975489 | 3975701 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 2 | 3600357 | 3600536 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 3 | 4358938 | 4359150 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 4 | 5077899 | 5078111 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 5 | 4032559 | 4032771 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 6 | 4649203 | 4649415 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 7 | 3751454 | 3751666 | - | NZ_CP029043.1 | Streptomyces nigra |
| 8 | 4305766 | 4305978 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 9 | 4882260 | 4882472 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 10 | 3580194 | 3580406 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 11 | 4420114 | 4420326 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 12 | 3958304 | 3958516 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 13 | 4026828 | 4027040 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 14 | 5064751 | 5064963 | - | NZ_CP022744.1 | Streptomyces lincolnensis |
| 15 | 4392373 | 4392585 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 16 | 3808988 | 3809200 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 17 | 5355018 | 5355230 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 18 | 5188057 | 5188269 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 19 | 4622769 | 4622981 | + | NZ_CP027306.1 | Streptomyces atratus |
| 20 | 4015215 | 4015394 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 21 | 5044995 | 5045207 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 22 | 5237173 | 5237385 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 23 | 4785899 | 4786111 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 24 | 294750 | 294962 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 25 | 4495914 | 4496126 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 26 | 3726830 | 3727042 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 27 | 4353456 | 4353668 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 28 | 3357568 | 3357747 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 29 | 4075771 | 4075983 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 30 | 5080630 | 5080842 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 31 | 4858706 | 4858918 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 32 | 3922158 | 3922331 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 33 | 5004914 | 5005126 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 34 | 10714451 | 10714663 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 35 | 3549993 | 3550205 | - | NZ_CP022310.1 | Streptomyces calvus |
| 36 | 4460056 | 4460235 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 37 | 3808464 | 3808640 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 38 | 4708148 | 4708360 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 39 | 3352782 | 3352958 | - | NC_020990.1 | Streptomyces albidoflavus |
| 40 | 3972749 | 3972928 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 41 | 3548907 | 3549083 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 42 | 3504987 | 3505175 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 43 | 4397957 | 4398169 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 44 | 3858383 | 3858562 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 45 | 4301021 | 4301200 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 46 | 3495017 | 3495199 | - | NZ_CP031194.1 | Streptomyces paludis |
| 47 | 4908573 | 4908800 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 48 | 4559635 | 4559814 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 49 | 4749283 | 4749465 | - | NZ_CP022685.1 | Streptomyces formicae |
| 50 | 3349522 | 3349698 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 51 | 4788223 | 4788435 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 52 | 4401141 | 4401353 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 53 | 5086705 | 5086887 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 54 | 4298964 | 4299146 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 55 | 3677605 | 3677784 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 56 | 3955056 | 3955235 | + | NZ_CP070242.1 | Streptomyces californicus |
| 57 | 3972099 | 3972278 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 58 | 3081540 | 3081752 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 59 | 46605 | 46814 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 60 | 4277482 | 4277661 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 61 | 3770343 | 3770555 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 62 | 6820516 | 6820701 | - | NZ_CP030862.1 | Streptomyces globosus |
| 63 | 3918558 | 3918755 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 64 | 3843815 | 3843997 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 65 | 4021824 | 4022003 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 66 | 5759966 | 5760160 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 67 | 4649619 | 4649816 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 68 | 3810192 | 3810389 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 69 | 5122841 | 5123059 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 70 | 3845317 | 3845499 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 71 | 3652685 | 3652870 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 72 | 3065856 | 3066068 | - | NZ_CP054938.1 | Streptomyces harbinensis |
| 73 | 2860298 | 2860510 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 74 | 3790840 | 3791010 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 75 | 3764057 | 3764266 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 76 | 3903029 | 3903208 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 77 | 4311056 | 4311238 | + | NZ_CP060404.1 | Streptomyces buecherae |
| 78 | 6549523 | 6549702 | - | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 79 | 4433934 | 4434104 | + | NZ_CP019457.1 | Streptomyces lydicus |
| 80 | 3258776 | 3258949 | + | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 81 | 3394098 | 3394271 | + | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 82 | 5115643 | 5115825 | + | NZ_CP070326.1 | Streptomyces noursei |
| 83 | 4870141 | 4870314 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 84 | 4510357 | 4510530 | + | NZ_CP023691.1 | Streptomyces platensis |
| 85 | 4567259 | 4567429 | - | NZ_CP023688.1 | Streptomyces rimosus |
| 86 | 4067189 | 4067362 | + | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012382.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01964.20 | 0.99 | 85 | 3440 | same-strand | Radical SAM ThiC family |
| 2 | PF13667.8 | 0.99 | 85 | 3440 | same-strand | ThiC-associated domain |
| 3 | PF07907.13 | 0.99 | 85 | 1736 | opposite-strand | YibE/F-like protein |
| 4 | PF04686.14 | 0.95 | 82 | 1188.5 | same-strand | Streptomyces sporulation and cell division protein, SsgA |
| 5 | PF09339.12 | 0.79 | 68 | 311.0 | same-strand | IclR helix-turn-helix domain |
| 6 | PF07883.13 | 0.99 | 85 | 176 | same-strand | Cupin domain |
| 7 | PF11699.10 | 0.97 | 83 | 176 | same-strand | Mif2/CENP-C like |
| 8 | PF04020.15 | 0.98 | 84 | 553.5 | opposite-strand | Mycobacterial 4 TMS phage holin, superfamily IV |
| 9 | PF01451.23 | 0.63 | 54 | 928.0 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
| 10 | PF01053.22 | 0.99 | 85 | 1410 | opposite-strand | Cys/Met metabolism PLP-dependent enzyme |
| 11 | PF03466.22 | 0.83 | 71 | 2793 | opposite-strand | LysR substrate binding domain |
| 12 | PF00126.29 | 0.83 | 71 | 2793 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..