Result : Q53462
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exoenzymes regulatory protein AepH |
| NCBI Accession ID | S74077.1 |
| Organism | Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora) |
| Left | 576 |
| Right | 719 |
| Strand | + |
| Nucleotide Sequence | GTGGGGCAGGAGCCTAAAGGGATTGAATCACGGAAGATACAGGATGGACACGTCAGGAAGAAAGTGGGACGCCAGCAAGGATTGTGGGTTAGGACGACCAAAAAGGAAAAGTTTTCACGGATGAGCAGGGATGCAAATGTGTAG |
| Sequence | MGQEPKGIESRKIQDGHVRKKVGRQQGLWVRTTKKEKFSRMSRDANV |
| Source of smORF | Swiss-Prot |
| Function | Involved in the control of extracellular enzymes production. Stimulates PEL, PEH, CEL, and PRT production. |
| Pubmed ID | 7944360 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q53462 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4979610 | 4979753 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 2 | 545429 | 545572 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 3 | 3696600 | 3696743 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 4 | 3876284 | 3876427 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 5 | 417586 | 417729 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 6 | 1141867 | 1142010 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 7 | 1174676 | 1174819 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 8 | 3057652 | 3057795 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 9 | 1237345 | 1237488 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 10 | 2005187 | 2005336 | + | NZ_CP023009.1 | Lonsdalea britannica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP047495.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18125.3 | 1.0 | 10 | 4554.0 | same-strand | RlmM ferredoxin-like domain |
| 2 | PF02739.18 | 1.0 | 10 | 3718.0 | opposite-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
| 3 | PF01367.22 | 1.0 | 10 | 3718.0 | opposite-strand | 5'-3' exonuclease, C-terminal SAM fold |
| 4 | PF11892.10 | 1.0 | 10 | 2245.5 | opposite-strand | Domain of unknown function (DUF3412) |
| 5 | PF14793.8 | 1.0 | 10 | 2245.5 | opposite-strand | Pyrimidine/purine nucleotide 5'-monophosphate nucleosidases |
| 6 | PF03641.16 | 1.0 | 10 | 2245.5 | opposite-strand | Possible lysine decarboxylase |
| 7 | PF14819.8 | 0.9 | 9 | 1045 | opposite-strand | Nitrile reductase, 7-cyano-7-deazaguanine-reductase N-term |
| 8 | PF14489.8 | 0.9 | 9 | 1045 | opposite-strand | QueF-like protein |
| 9 | PF07348.14 | 1.0 | 10 | 423.5 | same-strand | Syd protein (SUKH-2) |
| 10 | PF07969.13 | 0.6 | 6 | 260.5 | same-strand | Amidohydrolase family |
| 11 | PF12802.9 | 0.6 | 6 | 2196.5 | same-strand | MarR family |
| 12 | PF13463.8 | 0.6 | 6 | 2196.5 | same-strand | Winged helix DNA-binding domain |
| 13 | PF04287.14 | 1.0 | 10 | 2690.0 | same-strand | tRNA pseudouridine synthase C |
| 14 | PF00849.24 | 0.9 | 9 | 3033 | same-strand | RNA pseudouridylate synthase |
| 15 | PF00258.27 | 0.8 | 8 | 2635.0 | same-strand | Flavodoxin |
++ More..