Result : Q53202
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein FixU homolog |
| NCBI Accession ID | Z68203.1 |
| Organism | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Left | 16712 |
| Right | 16942 |
| Strand | - |
| Nucleotide Sequence | ATGAGGGTAACGATCCGCAGAAGCGGCAGCGGCTTGTCAGCGTATGTTCCCAAGAAAGATATCGAAGAGCCGATTGTCAAGGTTGAGAATGAAAGCCTGTGGGGCGGCTTTGTGGTGCTCAGAAATGGCTGGCGGCTCTTACTGCCCGACCTTCCGGAAGACACCAGCCTACCCGTAACCGTGGAGGCAAGGAAGATCGTGAATGATGCCGCGCGAAAAGAAACCTCATGA |
| Sequence | MRVTIRRSGSGLSAYVPKKDIEEPIVKVENESLWGGFVVLRNGWRLLLPDLPEDTSLPVTVEARKIVNDAARKETS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02351. Profile Description: NifT/FixU protein. This largely uncharacterized protein family is assigned a role in nitrogen fixation by two criteria. First, its gene occurs, generally, among genes essential for expression of active nitrogenase. Second, its phylogenetic profile closely matches that of nitrogen-fixing bacteria. However, mutational studies in Klebsiella pneumoniae failed to demonstrate any phenotype for deletion or overexpression of the protein. |
| Pubmed ID | 8796346 9163424 19376903 |
| Domain | CDD:413286 |
| Functional Category | Others |
| Uniprot ID | Q53202 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 83
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 221292 | 221522 | - | NZ_CP029453.1 | Sinorhizobium fredii CCBAU 25509 |
| 2 | 234682 | 234912 | - | NZ_CP023069.1 | Ensifer sojae CCBAU 05684 |
| 3 | 442304 | 442546 | + | NZ_CP034911.1 | Ensifer alkalisoli |
| 4 | 545735 | 545947 | + | NZ_CP015322.1 | Mesorhizobium amorphae CCNWGS0123 |
| 5 | 90896 | 91108 | - | NZ_CP013109.1 | Sinorhizobium americanum |
| 6 | 4727788 | 4728000 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 7 | 6362456 | 6362668 | + | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 8 | 6726319 | 6726531 | + | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 9 | 213093 | 213305 | - | NZ_CP032696.1 | Rhizobium jaguaris |
| 10 | 1021480 | 1021692 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 11 | 253746 | 253958 | - | NC_020061.1 | Rhizobium tropici CIAT 899 |
| 12 | 73613 | 73825 | + | NZ_CP050299.1 | Mesorhizobium huakuii |
| 13 | 354141 | 354353 | + | NZ_CP041240.1 | Ensifer mexicanus |
| 14 | 219838 | 220050 | - | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
| 15 | 584882 | 585094 | + | NZ_CP034999.1 | Rhizobium acidisoli |
| 16 | 286668 | 286880 | + | NZ_CP020910.1 | Rhizobium etli |
| 17 | 443247 | 443453 | - | NC_020527.1 | Sinorhizobium meliloti 2011 |
| 18 | 196368 | 196574 | + | NZ_CP071608.1 | Rhizobium binae |
| 19 | 313419 | 313631 | + | NZ_CP013502.1 | Rhizobium esperanzae |
| 20 | 309572 | 309784 | + | NZ_CP013535.1 | Rhizobium phaseoli |
| 21 | 4770609 | 4770821 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 22 | 1271091 | 1271297 | + | NZ_AP018907.1 | Blastochloris tepida |
| 23 | 2529857 | 2530063 | - | NZ_CP012946.1 | Blastochloris viridis |
| 24 | 98492 | 98698 | - | NZ_CP071610.1 | Rhizobium binae |
| 25 | 162572 | 162778 | - | NZ_CP071458.1 | Rhizobium lentis |
| 26 | 156482 | 156688 | + | NZ_CP071615.1 | Rhizobium bangladeshense |
| 27 | 309515 | 309721 | - | NZ_CP071682.1 | Rhizobium ruizarguesonis |
| 28 | 189695 | 189901 | - | NZ_CP054030.1 | Rhizobium hidalgonense |
| 29 | 217266 | 217472 | + | NZ_CP054024.1 | Rhizobium indicum |
| 30 | 4426585 | 4426800 | - | NZ_CP046052.1 | Methylocystis heyeri |
| 31 | 1100210 | 1100446 | + | NZ_HG938354.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 32 | 215448 | 215666 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 33 | 1656585 | 1656794 | + | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 34 | 720272 | 720487 | + | NZ_CP022220.1 | Bradyrhizobium guangxiense |
| 35 | 512704 | 512919 | + | NZ_CP030054.1 | Bradyrhizobium guangzhouense |
| 36 | 333111 | 333326 | + | NZ_CP030052.1 | Bradyrhizobium guangdongense |
| 37 | 3744933 | 3745142 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 38 | 3991057 | 3991269 | + | NZ_CP044331.1 | Methylocystis parvus |
| 39 | 1331365 | 1331574 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 40 | 1734462 | 1734671 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 41 | 32249 | 32461 | + | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 42 | 1172517 | 1172732 | + | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 43 | 5839173 | 5839385 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 44 | 5069869 | 5070069 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 45 | 1497306 | 1497524 | + | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 46 | 3265614 | 3265829 | - | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 47 | 8210 | 8428 | - | NZ_CP022991.1 | Paraburkholderia aromaticivorans |
| 48 | 1770320 | 1770538 | - | NC_007952.1 | Paraburkholderia xenovorans LB400 |
| 49 | 4001546 | 4001758 | - | NC_011666.1 | Methylocella silvestris BL2 |
| 50 | 4704344 | 4704568 | - | NC_017082.1 | Bradyrhizobium cosmicum |
| 51 | 984970 | 985176 | - | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 52 | 548416 | 548634 | + | NC_010627.1 | Paraburkholderia phymatum STM815 |
| 53 | 514280 | 514498 | + | NC_010627.1 | Paraburkholderia phymatum STM815 |
| 54 | 2633914 | 2634132 | - | NZ_CP017562.1 | Paraburkholderia sprentiae WSM5005 |
| 55 | 376482 | 376691 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
| 56 | 5376401 | 5376622 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 57 | 197223 | 197444 | + | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 58 | 2279757 | 2279966 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 59 | 3939853 | 3940071 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 60 | 1702893 | 1703111 | + | NZ_CP025086.1 | Methylovirgula ligni |
| 61 | 5705400 | 5705624 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 62 | 5574534 | 5574755 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 63 | 7115401 | 7115622 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 64 | 1701544 | 1701759 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 65 | 2609551 | 2609772 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 66 | 540718 | 540945 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
| 67 | 1667559 | 1667777 | + | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 68 | 1140518 | 1140727 | - | NZ_CP029353.1 | Azospirillum thermophilum |
| 69 | 1862703 | 1862915 | + | NC_006526.2 | Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821 |
| 70 | 462662 | 462874 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 71 | 921402 | 921611 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 72 | 2142116 | 2142340 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 73 | 1185854 | 1186069 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 74 | 413472 | 413687 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 75 | 1825006 | 1825215 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 76 | 3714763 | 3714969 | - | NZ_CP030265.1 | Skermanella pratensis |
| 77 | 1712461 | 1712685 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 78 | 3252766 | 3252975 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 79 | 2780299 | 2780508 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 80 | 1028690 | 1028914 | - | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 81 | 1854864 | 1855088 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 82 | 1743654 | 1743878 | + | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 83 | 1710948 | 1711163 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 84 | 1663591 | 1663800 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 85 | 2499253 | 2499462 | + | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 86 | 3316292 | 3316504 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015322.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04319.15 | 0.76 | 63 | 1220.0 | same-strand | NifZ domain |
| 2 | PF12838.9 | 0.6 | 50 | 416.0 | same-strand | 4Fe-4S dicluster domain |
| 3 | PF04055.23 | 0.65 | 54 | 652 | same-strand | Radical SAM superfamily |
| 4 | PF02579.19 | 0.64 | 53 | 664 | same-strand | Dinitrogenase iron-molybdenum cofactor |
| 5 | PF13289.8 | 0.73 | 61 | 43 | same-strand | SIR2-like domain |
++ More..