Result : A8FAY5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | |
| Organism | Bacillus pumilus (strain SAFR-032) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MTLIHYHAIITGRVQGVGFRYFVQGEAVNRGMKGWVRNTDEGHVELKVEGEQQEVLDFLKTVRKGSPFSKVTDMQMEQLPEFAHYQDFRIKG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 17895969 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A8FAY5 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 746696 | 746974 | + | NZ_CP043404.1 | Bacillus safensis |
| 2 | 750926 | 751204 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 3 | 867016 | 867294 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 4 | 799713 | 799943 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 5 | 846237 | 846548 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 6 | 880755 | 881027 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 7 | 3655230 | 3655460 | - | NZ_CP017703.1 | Aeribacillus pallidus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043404.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00557.26 | 0.86 | 6 | 1365.0 | same-strand | Metallopeptidase family M24 |
| 2 | PF11121.10 | 0.86 | 6 | 808.5 | same-strand | Protein of unknown function (DUF2639) |
| 3 | PF03473.19 | 0.86 | 6 | 116.5 | opposite-strand | MOSC domain |
| 4 | PF03475.16 | 0.86 | 6 | 116.5 | opposite-strand | 3-alpha domain |
| 5 | PF02898.17 | 0.71 | 5 | 1114 | opposite-strand | Nitric oxide synthase, oxygenase domain |
++ More..