Result : Q52331
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Transcriptional repressor protein KorC |
| NCBI Accession ID | M32794.1 |
| Organism | Escherichia coli |
| Left | 1169 |
| Right | 1426 |
| Strand | + |
| Nucleotide Sequence | ATGAGCGACGTGAATATCCGGCTTGAGTGCCTGCGCCCGGCGGAACGCTGGGTGCAGCCGACCGGCGCAGAAATCCGGGAAGTCTTGCACTTGGCCGGCCTCACCGGCGGACAGGCTGCGCGCATCTTGGGCTTGGGTGCCAAGGGCGACCGCACGGTGCGGCGTTGGGTTGGCGAGGATTCGCCGATCCCCTATGCCGCCTGGGCGATCCTTTGCGATCTAGCGGGGATTGGGGCGATCTGGAAAGGCCAGGGCTGA |
| Sequence | MSDVNIRLECLRPAERWVQPTGAEIREVLHLAGLTGGQAARILGLGAKGDRTVRRWVGEDSPIPYAAWAILCDLAGIGAIWKGQG |
| Source of smORF | Swiss-Prot |
| Function | Acts with KorA as corepressor in the control of the kilC and kilE operons. |
| Pubmed ID | 2160936 8349548 |
| Domain | |
| Functional Category | DNA-binding |
| Uniprot ID | Q52331 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 28214 | 28438 | + | NZ_CP019238.1 | Rhodoferax koreense |
| 2 | 23880 | 24104 | - | NZ_CP062809.1 | Cupriavidus basilensis |
| 3 | 47430 | 47684 | - | NC_017858.1 | Methylophaga frappieri |
| 4 | 58 | 312 | - | NC_017858.1 | Methylophaga frappieri |
| 5 | 5926 | 6180 | + | NC_017508.1 | Marinobacter adhaerens HP15 |
| 6 | 35141 | 35398 | + | NZ_CP043477.1 | Xanthomonas hyacinthi |
| 7 | 16779 | 17072 | + | NZ_CP046571.1 | Xanthomonas albilineans |
| 8 | 75184 | 75438 | - | NZ_CP020539.1 | Sphingobium herbicidovorans |
| 9 | 52001 | 52255 | - | NZ_CP028340.1 | Thauera aromatica K172 |
| 10 | 150708 | 150956 | + | NZ_CP066077.1 | Paraburkholderia ginsengisoli |
| 11 | 160943 | 161170 | + | NZ_CP031468.1 | Paraburkholderia caffeinilytica |
| 12 | 4295225 | 4295485 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 13 | 2016 | 2276 | - | NZ_CP026114.1 | Paraburkholderia terrae |
| 14 | 36375 | 36644 | - | NZ_CP013482.1 | Pandoraea apista |
| 15 | 323592 | 323870 | - | NC_010627.1 | Paraburkholderia phymatum STM815 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019238.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03230.15 | 0.71 | 10 | 1285.0 | same-strand | Antirestriction protein |
++ More..