Result : Q52278
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein KleA (KcrA1 protein) |
| NCBI Accession ID | U67194.4 |
| Organism | Escherichia coli |
| Left | 6077 |
| Right | 6313 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAAGAACAAGATCATGCCTTGGGTTGACGCCCTGCCGAATGTGGAAGCCACCGACTTCCAAGCCCGCCGCGACCAGATCGAGGCCACGATGGCCGAGGCGGCCGAGCTGGTGAAGCAGGCGGAAGAGCTGCGCGGCAAAGCCTATTTCGCCGCCTTGAGCCTGGAGGCCAGTGCCAAGGGCGAATGGTCGAGCCAAGCGGTCGAGCAGGCCAAGCGCAGCGTCGGCTGGTAA |
| Sequence | MSKNKIMPWVDALPNVEATDFQARRDQIEATMAEAAELVKQAEELRGKAYFAALSLEASAKGEWSSQAVEQAKRSVGW |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17383. Profile Description: Uncharacterized KorC regulated protein A. This is a family of unknown function found in Proteobacteria. |
| Pubmed ID | 7773415 |
| Domain | CDD:375166 |
| Functional Category | Others |
| Uniprot ID | Q52278 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 28598 | 28834 | + | NZ_CP019238.1 | Rhodoferax koreense |
| 2 | 23486 | 23722 | - | NZ_CP062809.1 | Cupriavidus basilensis |
| 3 | 51615 | 51833 | - | NZ_CP028340.1 | Thauera aromatica K172 |
| 4 | 6332 | 6568 | + | NC_017508.1 | Marinobacter adhaerens HP15 |
| 5 | 47043 | 47279 | - | NC_017858.1 | Methylophaga frappieri |
| 6 | 35589 | 35846 | + | NZ_CP043477.1 | Xanthomonas hyacinthi |
| 7 | 74798 | 74998 | - | NZ_CP020539.1 | Sphingobium herbicidovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019238.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03230.15 | 0.86 | 6 | 1600.0 | same-strand | Antirestriction protein |
| 2 | PF17394.4 | 0.86 | 6 | 172.0 | same-strand | Uncharacterized KleE stable inheritance protein |
| 3 | PF13614.8 | 0.86 | 6 | 1270.5 | same-strand | AAA domain |
| 4 | PF01656.25 | 0.86 | 6 | 1270.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
++ More..