Protein Information |
Information Type | Description |
---|---|
Protein name | Protein KleA (KcrA1 protein) |
NCBI Accession ID | U67194.4 |
Organism | Escherichia coli |
Left | 6077 |
Right | 6313 |
Strand | - |
Nucleotide Sequence | ATGAGCAAGAACAAGATCATGCCTTGGGTTGACGCCCTGCCGAATGTGGAAGCCACCGACTTCCAAGCCCGCCGCGACCAGATCGAGGCCACGATGGCCGAGGCGGCCGAGCTGGTGAAGCAGGCGGAAGAGCTGCGCGGCAAAGCCTATTTCGCCGCCTTGAGCCTGGAGGCCAGTGCCAAGGGCGAATGGTCGAGCCAAGCGGTCGAGCAGGCCAAGCGCAGCGTCGGCTGGTAA |
Sequence | MSKNKIMPWVDALPNVEATDFQARRDQIEATMAEAAELVKQAEELRGKAYFAALSLEASAKGEWSSQAVEQAKRSVGW |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17383. Profile Description: Uncharacterized KorC regulated protein A. This is a family of unknown function found in Proteobacteria. |
Pubmed ID | 7773415 |
Domain | CDD:375166 |
Functional Category | Others |
Uniprot ID | Q52278 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 28598 | 28834 | + | NZ_CP019238.1 | Rhodoferax koreense |
2 | 23486 | 23722 | - | NZ_CP062809.1 | Cupriavidus basilensis |
3 | 51615 | 51833 | - | NZ_CP028340.1 | Thauera aromatica K172 |
4 | 6332 | 6568 | + | NC_017508.1 | Marinobacter adhaerens HP15 |
5 | 47043 | 47279 | - | NC_017858.1 | Methylophaga frappieri |
6 | 35589 | 35846 | + | NZ_CP043477.1 | Xanthomonas hyacinthi |
7 | 74798 | 74998 | - | NZ_CP020539.1 | Sphingobium herbicidovorans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03230.15 | 0.86 | 6 | 1600.0 | same-strand | Antirestriction protein |
2 | PF17394.4 | 0.86 | 6 | 172.0 | same-strand | Uncharacterized KleE stable inheritance protein |
3 | PF13614.8 | 0.86 | 6 | 1270.5 | same-strand | AAA domain |
4 | PF01656.25 | 0.86 | 6 | 1270.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |