Result : Q51483
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein PA0522 |
| NCBI Accession ID | D37883.1 |
| Organism | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Left | 1493 |
| Right | 1750 |
| Strand | + |
| Nucleotide Sequence | ATGCGAACCCTGACCCTCTGCTGGCTGGCGTTGCTGGCGCTGGCCGTGACCGGTGTGCTGCTGGGTGGCGCCGGCGACTCTCCCTGGCTGCTGGCGGCGGTGCTGGCCTGCGCGGTGGCCAAGGGTTGGCTGATCGGCGAGCGCTTCATGGAGCTGGCCCATGCCCCGGCGCTATGGCGCCGCCTGCTGCTGGCCTGGCCGCTGCTGATGGCCCTGGCGGTGGGCGCTGCGCTGTACCTGGCGCGGATGAATAACTGA |
| Sequence | MRTLTLCWLALLALAVTGVLLGGAGDSPWLLAAVLACAVAKGWLIGERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7765251 10984043 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q51483 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 581668 | 581925 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 2443913 | 2444131 | + | NZ_CP027756.1 | Pseudomonas synxantha |
| 3 | 4285338 | 4285556 | - | NC_010170.1 | Bordetella petrii |
| 4 | 3117477 | 3117698 | + | NZ_CP068551.1 | Pseudomonas khazarica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002516.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13442.8 | 1.0 | 4 | 1620 | opposite-strand | Cytochrome C oxidase, cbb3-type, subunit III |
| 2 | PF00034.23 | 1.0 | 4 | 654 | same-strand | Cytochrome c |
| 3 | PF02239.18 | 0.75 | 3 | 1620 | opposite-strand | Cytochrome D1 heme domain |
| 4 | PF07728.16 | 1.0 | 4 | 617.5 | same-strand | AAA domain (dynein-related subfamily) |
| 5 | PF08406.12 | 1.0 | 4 | 617.5 | same-strand | CbbQ/NirQ/NorQ C-terminal |
| 6 | PF07726.13 | 0.75 | 3 | 613 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 7 | PF00115.22 | 1.0 | 4 | 675.0 | same-strand | Cytochrome C and Quinol oxidase polypeptide I |
| 8 | PF00027.31 | 1.0 | 4 | 4337.0 | opposite-strand | Cyclic nucleotide-binding domain |
| 9 | PF13545.8 | 1.0 | 4 | 4337.0 | opposite-strand | Crp-like helix-turn-helix domain |
++ More..