Result : Q51003
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Endoribonuclease VapD homolog (EC 3.1.-.-) (Virulence-associated protein D homolog) |
| NCBI Accession ID | M10316.1 |
| Organism | Neisseria gonorrhoeae |
| Left | 2355 |
| Right | 2633 |
| Strand | + |
| Nucleotide Sequence | ATGTACGCGATTTCTTTTGATTTGGTGGTTGCCGATACCGCTCAAAACCATCCGAAAGGCATTTCCCAAGCCTACGCGGATATTGGATACACCCTGCGGAAATTCGGCTTTACCCGCATTCAGGGAAGTTTGTACACCTGCCAAAACGAAGATATGGCTAACCTGTTTTCAGCCATCAACGAGCTAAAAGCTCTGCCTTGGTTTCCGTCTTCTGTCCGCGATATTCGGGCGTTCCGCATTGAGCAGTGGTCTGATTTCACAAGTCTTGTGAAGTCTTAA |
| Sequence | MYAISFDLVVADTAQNHPKGISQAYADIGYTLRKFGFTRIQGSLYTCQNEDMANLFSAINELKALPWFPSSVRDIRAFRIEQWSDFTSLVKS |
| Source of smORF | Swiss-Prot |
| Function | Cleaves ssRNA, mostly between U:A. {ECO:0000250}. |
| Pubmed ID | 2991186 |
| Domain | CDD:416272 |
| Functional Category | Others |
| Uniprot ID | Q51003 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 10955 | 11233 | + | NZ_CP059568.1 | Kingella oralis |
| 2 | 1323857 | 1324141 | - | NZ_CP022278.1 | Neisseria chenwenguii |
| 3 | 2753622 | 2753900 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 4 | 16122 | 16403 | - | NZ_AP021883.1 | Sulfuriferula nivalis |
| 5 | 39393 | 39674 | + | NZ_AP021882.1 | Sulfuriferula nivalis |
| 6 | 1695751 | 1696032 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 7 | 3149924 | 3150205 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
| 8 | 5528960 | 5529238 | + | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 9 | 572241 | 572519 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 10 | 6113611 | 6113895 | + | NZ_CP012938.1 | Bacteroides ovatus |
| 11 | 11952 | 12239 | + | NC_015165.1 | Phocaeicola salanitronis DSM 18170 |
| 12 | 932891 | 933193 | + | NZ_CP063145.1 | Cruoricaptor ignavus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP059568.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17375.4 | 0.67 | 6 | 0.0 | same-strand | Family of unknown function (DUF5397) |
++ More..