Result : Q50298
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translation initiation factor IF-1 |
| NCBI Accession ID | U34795.1 |
| Organism | Mycoplasma pneumoniae (strain ATCC 29342 / M129) |
| Left | 17196 |
| Right | 17432 |
| Strand | - |
| Nucleotide Sequence | ATGCAACCAAAGTTTAATAACCAAGCAAAGCAGGACAAACTCGTCTTAACGGGCAAAATCTTGGAAATCATCCACGGTGACAAGTTTCGCGTGTTGTTGGAAAACAACGTTGAAGTAGATGCTCACTTAGCGGGCAAAATGCGAATGCGCCGGTTACGAATTTTACCGGGCGATTTAGTTGAAGTGGAATTTTCCCCTTATGATTTAAAGTTAGGTCGAATAATAGGTAGAAAATAA |
| Sequence | MQPKFNNQAKQDKLVLTGKILEIIHGDKFRVLLENNVEVDAHLAGKMRMRRLRILPGDLVEVEFSPYDLKLGRIIGRK |
| Source of smORF | Swiss-Prot |
| Function | One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex. {ECO:0000255|HAMAP-Rule:MF_00075}. |
| Pubmed ID | 8604303 8948633 11271496 |
| Domain | CDD:415806 |
| Functional Category | RNA-binding |
| Uniprot ID | Q50298 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 685
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 228646 | 228882 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 2 | 202424 | 202636 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 3 | 785149 | 785361 | - | NZ_CP059674.1 | Mycoplasma tullyi |
| 4 | 835395 | 835607 | - | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 5 | 1317093 | 1317311 | - | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 6 | 1643221 | 1643436 | - | NZ_CP036425.1 | Poriferisphaera corsica |
| 7 | 275975 | 276175 | + | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
| 8 | 273444 | 273662 | + | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 9 | 299798 | 300016 | + | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 10 | 316776 | 316994 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 11 | 288571 | 288771 | + | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 12 | 64744 | 64962 | + | NZ_LR215023.1 | Mycoplasma iowae |
| 13 | 65522 | 65740 | - | NZ_CP024727.1 | Prevotella intermedia |
| 14 | 453495 | 453713 | + | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 15 | 1141281 | 1141499 | - | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 16 | 443669 | 443887 | + | NZ_CP023863.1 | Prevotella jejuni |
| 17 | 2033714 | 2033908 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 18 | 2856573 | 2856791 | + | NZ_CP040896.1 | Hymenobacter jejuensis |
| 19 | 762314 | 762511 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 20 | 1807825 | 1808019 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 21 | 1524525 | 1524743 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 22 | 1594162 | 1594380 | - | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 23 | 1608904 | 1609122 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 24 | 2130756 | 2130974 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 25 | 473090 | 473308 | + | NZ_AP019845.1 | Leptotrichia trevisanii |
| 26 | 2666725 | 2666919 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 27 | 1377311 | 1377529 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 28 | 1525106 | 1525324 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 29 | 1367490 | 1367708 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 30 | 3254033 | 3254251 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 31 | 3837789 | 3838007 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 32 | 1090044 | 1090262 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 33 | 1094506 | 1094724 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 34 | 669782 | 670000 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 35 | 3400528 | 3400746 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 36 | 2846955 | 2847173 | - | NZ_LT608328.1 | Petrimonas mucosa |
| 37 | 2524929 | 2525147 | - | NC_014033.1 | Prevotella ruminicola 23 |
| 38 | 2674199 | 2674393 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 39 | 394668 | 394862 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 40 | 758005 | 758247 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 41 | 270453 | 270671 | + | NZ_CP013195.1 | Prevotella enoeca |
| 42 | 1049137 | 1049331 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 43 | 303436 | 303630 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 44 | 2052483 | 2052701 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 45 | 201436 | 201654 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 46 | 2823905 | 2824123 | - | NZ_LR134384.1 | Prevotella oris |
| 47 | 836042 | 836263 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 48 | 616448 | 616648 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 49 | 888912 | 889130 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 50 | 118064 | 118267 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 51 | 3101498 | 3101716 | + | NZ_CP015402.2 | Muribaculum intestinale |
| 52 | 3351961 | 3352179 | - | NZ_CP015217.1 | Leptospira tipperaryensis |
| 53 | 1689986 | 1690222 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 54 | 399223 | 399441 | + | NC_013515.1 | Streptobacillus moniliformis DSM 12112 |
| 55 | 299483 | 299701 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 56 | 253233 | 253451 | + | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 57 | 230365 | 230583 | + | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 58 | 1467659 | 1467877 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 59 | 1609461 | 1609679 | - | NZ_CP033614.1 | Leptospira kmetyi |
| 60 | 2296805 | 2296999 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 61 | 2742998 | 2743213 | + | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 62 | 1586767 | 1586985 | - | NC_015713.1 | Simkania negevensis Z |
| 63 | 3369656 | 3369874 | - | NZ_CP040840.1 | Leptospira weilii |
| 64 | 2173146 | 2173364 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 65 | 1058861 | 1059052 | - | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 66 | 156024 | 156242 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 67 | 1605959 | 1606177 | + | NZ_CP030142.1 | Leptospira mayottensis |
| 68 | 505488 | 505706 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 69 | 803278 | 803481 | - | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 70 | 86850 | 87071 | + | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 71 | 3095161 | 3095376 | - | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 72 | 630542 | 630760 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 73 | 3774646 | 3774864 | + | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 74 | 4676561 | 4676779 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 75 | 2254835 | 2255053 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 76 | 1470643 | 1470861 | + | NZ_CP025120.1 | Kangiella profundi |
| 77 | 87075 | 87272 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 78 | 2310292 | 2310510 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 79 | 1256959 | 1257150 | - | NZ_CP043026.1 | Spiroplasma chinense |
| 80 | 2625785 | 2626003 | - | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 81 | 1570130 | 1570348 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 82 | 1982737 | 1982955 | + | NZ_CP009621.1 | Pontibacter korlensis |
| 83 | 86407 | 86625 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 84 | 2236729 | 2236947 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 85 | 5269280 | 5269498 | + | NZ_CP048222.1 | Rhodocytophaga rosea |
| 86 | 2200366 | 2200584 | - | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 87 | 4499470 | 4499688 | + | NZ_CP021235.1 | Pontibacter actiniarum |
| 88 | 620359 | 620577 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 89 | 2866805 | 2867023 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 90 | 835312 | 835506 | + | NZ_CP036299.1 | Planctopirus ephydatiae |
| 91 | 5303555 | 5303749 | + | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 92 | 1764142 | 1764336 | - | NZ_CP016180.1 | Pasteurella skyensis |
| 93 | 1075270 | 1075473 | - | NZ_CP012622.1 | Spiroplasma cantharicola |
| 94 | 1169244 | 1169447 | - | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 95 | 1904225 | 1904443 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 96 | 1517896 | 1518114 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 97 | 199302 | 199520 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 98 | 719123 | 719341 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 99 | 1428257 | 1428475 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 100 | 765821 | 766039 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 101 | 1774421 | 1774639 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 102 | 751833 | 752051 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 103 | 2243122 | 2243340 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 104 | 796974 | 797192 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 105 | 1535423 | 1535638 | - | NZ_CP019633.1 | Sedimentisphaera cyanobacteriorum |
| 106 | 2035794 | 2036015 | + | NZ_CP042430.1 | Baekduia soli |
| 107 | 742491 | 742709 | + | NZ_CP042430.1 | Baekduia soli |
| 108 | 363512 | 363733 | - | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 109 | 713896 | 714117 | - | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 110 | 397169 | 397390 | - | NZ_LS398098.1 | Chlamydia suis |
| 111 | 1691298 | 1691516 | - | NZ_CP042437.1 | Mucilaginibacter ginsenosidivorax |
| 112 | 1719291 | 1719509 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 113 | 2160959 | 2161177 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 114 | 2567288 | 2567506 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 115 | 2262433 | 2262651 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 116 | 2306574 | 2306792 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 117 | 2010639 | 2010860 | - | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 118 | 357380 | 357577 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 119 | 5281217 | 5281435 | + | NC_013037.1 | Dyadobacter fermentans DSM 18053 |
| 120 | 1280218 | 1280436 | - | NZ_CP019914.1 | Brachyspira hampsonii |
| 121 | 2110986 | 2111204 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 122 | 199652 | 199870 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 123 | 3653354 | 3653572 | + | NZ_CP047897.1 | Nibribacter ruber |
| 124 | 283235 | 283453 | + | NZ_CP010777.1 | Rufibacter radiotolerans |
| 125 | 2883724 | 2883942 | + | NZ_CP012643.1 | Rufibacter tibetensis |
| 126 | 3645458 | 3645649 | - | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 127 | 2131044 | 2131262 | - | NZ_CP066775.1 | Mucilaginibacter ginkgonis |
| 128 | 1049457 | 1049675 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 129 | 1608771 | 1609007 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 130 | 4568962 | 4569180 | - | NZ_CP022743.1 | Mucilaginibacter xinganensis |
| 131 | 5079803 | 5080021 | - | NZ_CP042436.1 | Mucilaginibacter ginsenosidivorans |
| 132 | 6721987 | 6722205 | + | NZ_CP032869.1 | Mucilaginibacter celer |
| 133 | 3752515 | 3752733 | - | NZ_CP071878.1 | Mucilaginibacter gossypii |
| 134 | 1766045 | 1766263 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 135 | 2385981 | 2386199 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 136 | 2223743 | 2223961 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 137 | 233134 | 233352 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 138 | 397262 | 397456 | - | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 139 | 3547513 | 3547731 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 140 | 3290640 | 3290858 | + | NZ_CP047984.1 | Pontibacter russatus |
| 141 | 1220081 | 1220275 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 142 | 1444480 | 1444698 | - | NZ_CP032382.1 | Chryseolinea soli |
| 143 | 333926 | 334144 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 144 | 148299 | 148526 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 145 | 568574 | 568792 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 146 | 1760345 | 1760563 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 147 | 715378 | 715596 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 148 | 1289378 | 1289596 | + | NZ_CP027770.1 | Staphylococcus felis |
| 149 | 642004 | 642222 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 150 | 1659655 | 1659873 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 151 | 779476 | 779694 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 152 | 732812 | 733030 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 153 | 1970516 | 1970734 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 154 | 906377 | 906595 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 155 | 2191542 | 2191760 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 156 | 2697769 | 2697987 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 157 | 799506 | 799724 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 158 | 485603 | 485821 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 159 | 1969625 | 1969843 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 160 | 1797652 | 1797870 | + | NZ_CP020105.1 | Spirosoma rigui |
| 161 | 450639 | 450857 | - | NZ_CP020104.1 | Spirosoma aerolatum |
| 162 | 3754383 | 3754601 | - | NZ_CP025096.1 | Spirosoma pollinicola |
| 163 | 166103 | 166321 | - | NZ_CP050063.1 | Spirosoma aureum |
| 164 | 5135302 | 5135520 | - | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 165 | 687384 | 687578 | + | NZ_CP036250.1 | Egicoccus halophilus |
| 166 | 1993579 | 1993797 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 167 | 249258 | 249476 | + | NZ_CP047361.1 | Macrococcus canis |
| 168 | 2989178 | 2989396 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 169 | 3976901 | 3977119 | - | NZ_CP054139.1 | Mucilaginibacter mali |
| 170 | 2522134 | 2522352 | + | NZ_CP014766.1 | Pontibacter akesuensis |
| 171 | 1798858 | 1799076 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 172 | 972542 | 972769 | - | NZ_CP017015.1 | Spiroplasma helicoides |
| 173 | 44965 | 45183 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 174 | 513349 | 513567 | - | NZ_CP055156.1 | Adhaeribacter swui |
| 175 | 8560393 | 8560611 | - | NZ_CP017641.1 | Fuerstia marisgermanicae |
| 176 | 3214133 | 3214351 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 177 | 1305496 | 1305714 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 178 | 1046496 | 1046723 | - | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 179 | 2484928 | 2485146 | - | NC_015177.1 | Pseudopedobacter saltans DSM 12145 |
| 180 | 646023 | 646241 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 181 | 1113651 | 1113869 | + | NZ_AP017313.1 | Mucilaginibacter gotjawali |
| 182 | 174601 | 174819 | + | NZ_CP010650.1 | Phaeobacter inhibens |
| 183 | 155076 | 155294 | + | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 184 | 3260124 | 3260342 | - | NZ_CP032489.1 | Arachidicoccus soli |
| 185 | 374666 | 374884 | - | NZ_CP015093.1 | Salipiger abyssi |
| 186 | 298509 | 298727 | + | NZ_CP030032.1 | Bradymonas sediminis |
| 187 | 2156873 | 2157094 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 188 | 3729509 | 3729727 | + | NZ_CP041159.1 | Leisingera aquaemixtae |
| 189 | 3571938 | 3572156 | - | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 190 | 1070941 | 1071168 | - | NZ_CP012357.1 | Spiroplasma litorale |
| 191 | 3150365 | 3150583 | + | NZ_CP042434.1 | Arachidicoccus ginsenosidivorans |
| 192 | 393206 | 393424 | + | NZ_CP015231.1 | Epibacterium mobile F1926 |
| 193 | 559370 | 559588 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 194 | 970945 | 971148 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 195 | 3203701 | 3203919 | - | NZ_CP016364.1 | Phaeobacter porticola |
| 196 | 60422 | 60640 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 197 | 2248621 | 2248839 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 198 | 73720 | 73938 | + | NC_006569.1 | Ruegeria pomeroyi DSS-3 |
| 199 | 282309 | 282527 | + | NC_022549.1 | Acholeplasma brassicae |
| 200 | 1515619 | 1515822 | - | NZ_CP014161.1 | Aerococcus urinae |
| 201 | 3776789 | 3777007 | + | NZ_CP027407.1 | Roseobacter denitrificans |
| 202 | 1029055 | 1029294 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 203 | 1833810 | 1834034 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 204 | 578441 | 578668 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 205 | 3087247 | 3087465 | - | NC_015730.1 | Roseobacter litoralis Och 149 |
| 206 | 3587228 | 3587446 | - | NC_008255.1 | Cytophaga hutchinsonii ATCC 33406 |
| 207 | 3575682 | 3575900 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 208 | 843790 | 844011 | - | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 209 | 3602019 | 3602237 | + | NC_014759.1 | Marivirga tractuosa DSM 4126 |
| 210 | 1503499 | 1503702 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 211 | 1433736 | 1433930 | - | NZ_LS483470.1 | Leminorella richardii |
| 212 | 300594 | 300797 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 213 | 2100590 | 2100784 | - | NZ_CP059567.1 | Neisseria shayeganii |
| 214 | 622524 | 622742 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 215 | 701979 | 702197 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 216 | 277747 | 277965 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 217 | 1392027 | 1392230 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 218 | 359410 | 359607 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 219 | 805933 | 806130 | - | NC_017287.1 | Chlamydia psittaci 6BC |
| 220 | 807828 | 808025 | - | NC_003361.3 | Chlamydia caviae GPIC |
| 221 | 435309 | 435527 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 222 | 2123415 | 2123633 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 223 | 1072542 | 1072760 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 224 | 1513425 | 1513628 | + | NZ_AP017422.1 | Filimonas lacunae |
| 225 | 2944583 | 2944801 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 226 | 154141 | 154359 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 227 | 580477 | 580671 | + | NZ_CP059564.1 | Alysiella filiformis |
| 228 | 558031 | 558249 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 229 | 1375442 | 1375660 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 230 | 1271348 | 1271569 | - | NZ_CP029476.1 | Lactobacillus apis |
| 231 | 281057 | 281275 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 232 | 2480904 | 2481122 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 233 | 188489 | 188707 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 234 | 6988804 | 6989022 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 235 | 6074903 | 6075121 | - | NZ_CP043930.1 | Gimesia benthica |
| 236 | 2799461 | 2799679 | - | NZ_CP048106.1 | Pontibacter pudoricolor |
| 237 | 4434919 | 4435137 | - | NZ_CP060723.1 | Pedobacter roseus |
| 238 | 1557259 | 1557477 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 239 | 3197618 | 3197839 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 240 | 475296 | 475490 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 241 | 191790 | 191987 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 242 | 3698191 | 3698412 | + | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 243 | 640572 | 640763 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 244 | 1117046 | 1117264 | - | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 245 | 8108635 | 8108853 | + | NZ_CP032157.1 | Paraflavitalea soli |
| 246 | 610661 | 610855 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 247 | 524703 | 524921 | + | NZ_CP038029.1 | Sphingobacterium psychroaquaticum |
| 248 | 2170163 | 2170366 | - | NZ_CP030126.1 | Indioceanicola profundi |
| 249 | 658880 | 659074 | + | NZ_CP013729.1 | Roseateles depolymerans |
| 250 | 140006 | 140200 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 251 | 848269 | 848463 | - | NZ_LR134510.1 | Actinobacillus delphinicola |
| 252 | 811061 | 811252 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 253 | 2256239 | 2256457 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 254 | 28488 | 28706 | + | NZ_CP034562.1 | Flammeovirga pectinis |
| 255 | 324959 | 325177 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 256 | 548946 | 549140 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 257 | 470222 | 470455 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 258 | 484160 | 484381 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 259 | 1117787 | 1118005 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 260 | 3159155 | 3159373 | - | NZ_CP048788.1 | Roseobacter ponti |
| 261 | 1998356 | 1998574 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 262 | 6244812 | 6245030 | + | NZ_CP010429.1 | Spirosoma radiotolerans |
| 263 | 1891244 | 1891444 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 264 | 572152 | 572370 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 265 | 6033260 | 6033454 | - | NZ_CP028324.1 | Massilia armeniaca |
| 266 | 573831 | 574046 | - | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 267 | 1190580 | 1190798 | - | NZ_CP021904.1 | Alkalitalea saponilacus |
| 268 | 3054126 | 3054347 | + | NZ_CP007451.1 | Draconibacterium orientale |
| 269 | 1364434 | 1364628 | + | NZ_CP018804.1 | Histophilus somni |
| 270 | 2059654 | 2059848 | - | NZ_LR134167.1 | Avibacterium volantium |
| 271 | 1536701 | 1536922 | - | NZ_AP018042.1 | Labilibaculum antarcticum |
| 272 | 1086470 | 1086664 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 273 | 1705081 | 1705299 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 274 | 140023 | 140241 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 275 | 2088902 | 2089120 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 276 | 2014488 | 2014706 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 277 | 455010 | 455228 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 278 | 375489 | 375707 | - | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 279 | 537261 | 537479 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 280 | 1106759 | 1106977 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 281 | 1856546 | 1856764 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 282 | 2101271 | 2101495 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 283 | 422816 | 423034 | - | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 284 | 5405827 | 5406045 | + | NZ_CP036353.1 | Gimesia maris |
| 285 | 673658 | 673852 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 286 | 140241 | 140459 | + | NZ_LS483476.1 | Lederbergia lentus |
| 287 | 1184425 | 1184643 | - | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 288 | 2609423 | 2609617 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 289 | 1883268 | 1883462 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 290 | 2632779 | 2632973 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 291 | 1510311 | 1510505 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 292 | 3336363 | 3336557 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 293 | 1509698 | 1509892 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 294 | 2524728 | 2524922 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 295 | 1423027 | 1423221 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 296 | 1554420 | 1554614 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 297 | 1590465 | 1590659 | - | NZ_LR134340.1 | Escherichia marmotae |
| 298 | 3464817 | 3465011 | - | NZ_CP053416.1 | Salmonella bongori |
| 299 | 4561470 | 4561664 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 300 | 877597 | 877791 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 301 | 926225 | 926419 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 302 | 951838 | 952032 | - | NZ_AP014857.1 | Escherichia albertii |
| 303 | 3047158 | 3047352 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 304 | 1654701 | 1654895 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 305 | 2032696 | 2032890 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 306 | 3230485 | 3230679 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 307 | 1030350 | 1030544 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 308 | 1420880 | 1421074 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 309 | 1644591 | 1644785 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 310 | 1335524 | 1335718 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 311 | 3188812 | 3189006 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 312 | 3455531 | 3455725 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 313 | 3419082 | 3419276 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 314 | 1849366 | 1849560 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 315 | 1037047 | 1037241 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 316 | 2834158 | 2834352 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 317 | 3518578 | 3518772 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 318 | 4024796 | 4024990 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 319 | 3907049 | 3907243 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 320 | 1057303 | 1057497 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 321 | 2789540 | 2789734 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 322 | 3672570 | 3672764 | + | NZ_CP054254.1 | Klebsiella variicola |
| 323 | 1673054 | 1673248 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 324 | 1112025 | 1112219 | - | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 325 | 375663 | 375881 | - | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 326 | 1938156 | 1938374 | + | NZ_CP013909.1 | Hymenobacter sedentarius |
| 327 | 2857165 | 2857383 | - | NZ_CP029145.1 | Hymenobacter nivis |
| 328 | 1504860 | 1505075 | + | NZ_CP006828.1 | Ornithobacterium rhinotracheale ORT-UMN 88 |
| 329 | 883084 | 883302 | + | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 330 | 3571925 | 3572143 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 331 | 315522 | 315740 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 332 | 1541934 | 1542128 | - | NC_016043.1 | Taylorella asinigenitalis MCE3 |
| 333 | 80273 | 80476 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 334 | 606811 | 607005 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 335 | 160832 | 161050 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 336 | 2979466 | 2979684 | - | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 337 | 4056502 | 4056720 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 338 | 243428 | 243646 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 339 | 3906957 | 3907175 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 340 | 3866870 | 3867088 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 341 | 4589315 | 4589533 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 342 | 7998368 | 7998586 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 343 | 3760945 | 3761163 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 344 | 5955535 | 5955753 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 345 | 460845 | 461063 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 346 | 2967686 | 2967880 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 347 | 1328839 | 1329042 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 348 | 102686 | 102904 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 349 | 314314 | 314508 | + | NZ_CP028926.1 | Pasteurella multocida |
| 350 | 1278466 | 1278660 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 351 | 396834 | 397055 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 352 | 223763 | 223984 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 353 | 59279 | 59473 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 354 | 400104 | 400325 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 355 | 1142396 | 1142617 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 356 | 1467880 | 1468101 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 357 | 1347508 | 1347726 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 358 | 430223 | 430441 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 359 | 3311817 | 3312011 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 360 | 3147379 | 3147594 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 361 | 2515928 | 2516122 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 362 | 1849731 | 1849925 | - | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 363 | 417611 | 417814 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 364 | 2220591 | 2220785 | + | NZ_CP020046.1 | Thiomonas intermedia |
| 365 | 3418433 | 3418636 | - | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 366 | 397535 | 397753 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 367 | 3548139 | 3548357 | - | NC_017770.1 | Solitalea canadensis DSM 3403 |
| 368 | 131641 | 131835 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 369 | 3276390 | 3276584 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 370 | 665858 | 666052 | + | NZ_CP040709.1 | Inhella inkyongensis |
| 371 | 1415670 | 1415873 | - | NZ_CP004393.1 | Celeribacter indicus |
| 372 | 998416 | 998634 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 373 | 2131213 | 2131407 | + | NZ_CP046531.1 | Mannheimia ovis |
| 374 | 2143941 | 2144135 | + | NZ_CP061280.1 | Mannheimia bovis |
| 375 | 2158601 | 2158795 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 376 | 571594 | 571812 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 377 | 471789 | 471983 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 378 | 1573100 | 1573294 | - | NZ_CP021060.1 | Taylorella equigenitalis |
| 379 | 3087083 | 3087277 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 380 | 139707 | 139901 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 381 | 2833359 | 2833553 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 382 | 133434 | 133628 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 383 | 2256460 | 2256654 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 384 | 343218 | 343439 | + | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 385 | 136979 | 137173 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 386 | 5055467 | 5055685 | + | NZ_CP024091.1 | Pedobacter ginsengisoli |
| 387 | 473419 | 473637 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 388 | 481204 | 481422 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 389 | 990935 | 991129 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 390 | 1445010 | 1445204 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 391 | 118700 | 118894 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 392 | 143893 | 144087 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 393 | 2103589 | 2103783 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 394 | 2221692 | 2221886 | - | NZ_CP046378.1 | Shewanella algae |
| 395 | 3082015 | 3082209 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 396 | 2066880 | 2067074 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 397 | 1926754 | 1926948 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 398 | 599104 | 599298 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 399 | 338464 | 338658 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 400 | 733782 | 734000 | + | NC_013061.1 | Pedobacter heparinus DSM 2366 |
| 401 | 48995 | 49189 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 402 | 515168 | 515386 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 403 | 3361516 | 3361734 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 404 | 153346 | 153540 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 405 | 274106 | 274321 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 406 | 468555 | 468749 | - | NZ_CP009056.1 | Frischella perrara |
| 407 | 2485887 | 2486105 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 408 | 2722393 | 2722587 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 409 | 3479423 | 3479617 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 410 | 6458081 | 6458275 | - | NZ_CP036401.1 | Massilia albidiflava |
| 411 | 1085946 | 1086164 | - | NZ_CP035510.1 | Haematobacter massiliensis |
| 412 | 449567 | 449785 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 413 | 2124902 | 2125120 | + | NZ_CP042433.1 | Flavisolibacter ginsenosidimutans |
| 414 | 2321404 | 2321622 | + | NZ_CP023777.1 | Chitinophaga caeni |
| 415 | 1977042 | 1977260 | + | NC_013132.1 | Chitinophaga pinensis DSM 2588 |
| 416 | 766297 | 766491 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 417 | 333072 | 333287 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 418 | 2842403 | 2842597 | - | NZ_CP026364.1 | Proteus hauseri |
| 419 | 1241483 | 1241677 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 420 | 3747680 | 3747874 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 421 | 751597 | 751791 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 422 | 3179946 | 3180140 | + | NZ_CP048796.1 | Providencia vermicola |
| 423 | 3057491 | 3057685 | + | NZ_LS483422.1 | Providencia heimbachae |
| 424 | 2119022 | 2119216 | - | NZ_CP029736.1 | Providencia rettgeri |
| 425 | 675825 | 676019 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 426 | 843614 | 843832 | + | NZ_CP030848.1 | Sphingobacterium hotanense |
| 427 | 5876616 | 5876834 | + | NZ_CP048113.1 | Chitinophaga agri |
| 428 | 1558203 | 1558406 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 429 | 1685564 | 1685758 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 430 | 2631848 | 2632066 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 431 | 3964248 | 3964466 | - | NZ_LR590470.1 | Sphingobacterium daejeonense |
| 432 | 5111417 | 5111644 | + | NC_009511.1 | Sphingomonas wittichii RW1 |
| 433 | 1063572 | 1063790 | - | NZ_CP012661.1 | Defluviimonas alba |
| 434 | 1215998 | 1216216 | + | NZ_CP013002.1 | Caulobacter henricii |
| 435 | 1355860 | 1356078 | + | NZ_CP049246.1 | Sphingobacterium lactis |
| 436 | 3053017 | 3053220 | + | NZ_CP044331.1 | Methylocystis parvus |
| 437 | 1332663 | 1332857 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 438 | 1646047 | 1646265 | - | NZ_CP060436.1 | Pseudooceanicola algae |
| 439 | 192050 | 192271 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 440 | 2652771 | 2652989 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 441 | 468673 | 468879 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 442 | 781245 | 781439 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 443 | 300710 | 300928 | + | NZ_CP013197.1 | Spiroplasma citri |
| 444 | 2465684 | 2465902 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 445 | 1143960 | 1144163 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 446 | 523598 | 523816 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 447 | 250061 | 250279 | + | NZ_AP019367.1 | Parolsenella catena |
| 448 | 3087591 | 3087794 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 449 | 979793 | 979987 | - | NZ_CP015029.1 | Frederiksenia canicola |
| 450 | 856733 | 856951 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 451 | 223398 | 223616 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 452 | 3433922 | 3434140 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 453 | 148932 | 149126 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 454 | 181083 | 181277 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 455 | 168777 | 168995 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 456 | 1638902 | 1639120 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 457 | 1130725 | 1130940 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 458 | 4747709 | 4747927 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 459 | 683057 | 683272 | - | NZ_CP029258.1 | Mycoplasmopsis synoviae |
| 460 | 1926420 | 1926614 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 461 | 6023653 | 6023856 | + | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
| 462 | 2790929 | 2791123 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 463 | 5302442 | 5302636 | - | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 464 | 769152 | 769346 | + | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 465 | 4630837 | 4631031 | + | NZ_CP041185.1 | Janthinobacterium tructae |
| 466 | 731088 | 731282 | + | NZ_CP048832.1 | Janthinobacterium lividum |
| 467 | 5419070 | 5419264 | + | NZ_CP040017.1 | Massilia umbonata |
| 468 | 2226455 | 2226673 | + | NZ_LT828648.1 | Nitrospira japonica |
| 469 | 448282 | 448476 | + | NZ_CP013236.1 | Collimonas pratensis |
| 470 | 1630971 | 1631189 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 471 | 3406328 | 3406522 | - | NZ_CP018845.1 | Herbaspirillum robiniae |
| 472 | 143975 | 144169 | + | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 473 | 161326 | 161520 | + | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 474 | 1384872 | 1385066 | - | NZ_CP034464.1 | Undibacterium parvum |
| 475 | 956680 | 956874 | + | NZ_CP024608.1 | Massilia violaceinigra |
| 476 | 2106652 | 2106867 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 477 | 2929080 | 2929298 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 478 | 2596860 | 2597054 | + | NZ_CP041036.1 | Shewanella polaris |
| 479 | 4565661 | 4565879 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 480 | 2946929 | 2947147 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 481 | 4171808 | 4172011 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 482 | 261941 | 262159 | + | NZ_CP053989.1 | Niallia circulans |
| 483 | 681767 | 681964 | + | NZ_LT859958.1 | Brevefilum fermentans |
| 484 | 584484 | 584702 | + | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 485 | 277848 | 278066 | - | NZ_CP026363.1 | Brevibacillus agri |
| 486 | 278942 | 279136 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 487 | 4272788 | 4272982 | + | NZ_CP046904.1 | Massilia flava |
| 488 | 2140445 | 2140639 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 489 | 573453 | 573647 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 490 | 618242 | 618436 | + | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 491 | 299107 | 299301 | + | NZ_AP018150.1 | Mycoavidus cysteinexigens |
| 492 | 1242684 | 1242878 | - | NZ_CP009654.1 | Francisella frigiditurris |
| 493 | 1174647 | 1174862 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 494 | 2629826 | 2630020 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 495 | 1799009 | 1799203 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 496 | 64812 | 65006 | - | NZ_LT907988.1 | Orrella dioscoreae |
| 497 | 2274522 | 2274716 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 498 | 3302379 | 3302573 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 499 | 2413526 | 2413720 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 500 | 2490529 | 2490723 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 501 | 2333937 | 2334155 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 502 | 407952 | 408173 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 503 | 1340213 | 1340431 | - | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 504 | 2389218 | 2389436 | + | NZ_CP037755.1 | Pseudocnuella soli |
| 505 | 3782767 | 3782961 | - | NZ_CP011937.1 | Bacillus velezensis |
| 506 | 283598 | 283792 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 507 | 147548 | 147742 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 508 | 148581 | 148775 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 509 | 147321 | 147515 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 510 | 147434 | 147628 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 511 | 117329 | 117523 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 512 | 1861889 | 1862083 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 513 | 147609 | 147803 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 514 | 335866 | 336060 | + | NZ_CP013235.1 | Collimonas arenae |
| 515 | 722407 | 722601 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 516 | 808579 | 808773 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 517 | 2333962 | 2334180 | + | NZ_CP046268.1 | Vibrio spartinae |
| 518 | 3193654 | 3193848 | + | NZ_CP061941.1 | Marinomonas algicola |
| 519 | 2428011 | 2428229 | - | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 520 | 2162580 | 2162774 | - | NC_007954.1 | Shewanella denitrificans OS217 |
| 521 | 4108570 | 4108764 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 522 | 4509655 | 4509849 | - | NZ_CP036200.1 | Shewanella maritima |
| 523 | 2278473 | 2278667 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 524 | 2698241 | 2698435 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 525 | 412644 | 412838 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 526 | 2121409 | 2121603 | - | NZ_CP020472.1 | Shewanella japonica |
| 527 | 254968 | 255186 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 528 | 483279 | 483473 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 529 | 275629 | 275847 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 530 | 229329 | 229550 | - | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 531 | 1158799 | 1159017 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 532 | 1205566 | 1205784 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 533 | 3058839 | 3059033 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 534 | 1286362 | 1286580 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 535 | 158330 | 158533 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 536 | 3740099 | 3740293 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 537 | 2416585 | 2416779 | + | NZ_CP037951.1 | Parashewanella tropica |
| 538 | 2750095 | 2750289 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 539 | 2032241 | 2032435 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 540 | 3007097 | 3007291 | + | NC_016901.1 | Shewanella baltica OS678 |
| 541 | 1672637 | 1672855 | - | NZ_CP011390.1 | Flavisolibacter tropicus |
| 542 | 870402 | 870596 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 543 | 1551478 | 1551717 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 544 | 385940 | 386134 | + | NC_012968.1 | Methylotenera mobilis JLW8 |
| 545 | 983314 | 983508 | - | NZ_CP007445.1 | Gilliamella apicola |
| 546 | 95926 | 96144 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 547 | 106392 | 106586 | + | NZ_CP022355.1 | Paraphotobacterium marinum |
| 548 | 2570674 | 2570892 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 549 | 2406091 | 2406309 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 550 | 3411231 | 3411449 | - | NZ_CP027850.1 | Caulobacter segnis |
| 551 | 1688196 | 1688417 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 552 | 4325202 | 4325396 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 553 | 2340286 | 2340480 | - | NZ_CP014056.2 | Grimontia hollisae |
| 554 | 2759281 | 2759499 | - | NZ_CP036532.1 | Roseitalea porphyridii |
| 555 | 40402 | 40605 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 556 | 3426590 | 3426784 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 557 | 145724 | 145918 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 558 | 178204 | 178398 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 559 | 154194 | 154388 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 560 | 139271 | 139489 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 561 | 4980991 | 4981209 | - | NZ_CP040336.1 | Bacillus luti |
| 562 | 132962 | 133180 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 563 | 138403 | 138621 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 564 | 138607 | 138825 | + | NC_011725.1 | Bacillus cereus B4264 |
| 565 | 138326 | 138544 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 566 | 513411 | 513629 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 567 | 3526807 | 3527001 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 568 | 741316 | 741519 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 569 | 1065865 | 1066086 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 570 | 94759 | 94962 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 571 | 568170 | 568373 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 572 | 1646133 | 1646327 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 573 | 95449 | 95655 | + | NZ_CP060718.1 | Sphingomonas lutea |
| 574 | 933603 | 933800 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 575 | 1235404 | 1235607 | + | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 576 | 93613 | 93831 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 577 | 3942752 | 3942970 | - | NZ_CP019870.1 | Clostridioides difficile |
| 578 | 1402291 | 1402494 | + | NZ_CP034588.1 | Silicimonas algicola |
| 579 | 1136103 | 1136321 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 580 | 5452611 | 5452829 | - | NZ_CP026100.1 | Caulobacter flavus |
| 581 | 2816288 | 2816506 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 582 | 2080413 | 2080631 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 583 | 319624 | 319842 | - | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 584 | 2771188 | 2771409 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 585 | 560088 | 560306 | + | NZ_CP036276.1 | Symmachiella dynata |
| 586 | 1091683 | 1091907 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 587 | 1908618 | 1908836 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 588 | 896591 | 896785 | + | NZ_CP022375.1 | Francisella opportunistica |
| 589 | 984909 | 985103 | + | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 590 | 1381186 | 1381380 | + | NC_015696.1 | Francisella salina |
| 591 | 791156 | 791350 | + | NZ_CP043552.1 | Francisella marina |
| 592 | 1091874 | 1092068 | - | NZ_CP022132.1 | Francisella halioticida |
| 593 | 1045931 | 1046125 | + | NZ_CP016796.1 | Francisella uliginis |
| 594 | 67464 | 67658 | + | NZ_CP030086.1 | Polynucleobacter paneuropaeus |
| 595 | 2124899 | 2125117 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 596 | 3811380 | 3811598 | - | NZ_CP009687.1 | Clostridium aceticum |
| 597 | 1875380 | 1875583 | - | NZ_CP042435.1 | Panacibacter ginsenosidivorans |
| 598 | 402774 | 402998 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 599 | 140254 | 140472 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 600 | 2012426 | 2012644 | - | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 601 | 3253701 | 3253919 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
| 602 | 250402 | 250605 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 603 | 721888 | 722079 | + | NZ_CP048649.1 | Aminipila butyrica |
| 604 | 2013160 | 2013354 | + | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 605 | 324497 | 324715 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 606 | 103110 | 103328 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 607 | 1446656 | 1446877 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 608 | 2986837 | 2987052 | + | NC_015844.1 | Zobellia galactanivorans |
| 609 | 700642 | 700860 | + | NZ_LT821227.1 | Phoenicibacter congonensis |
| 610 | 5574795 | 5575013 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 611 | 1480757 | 1480951 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 612 | 120887 | 121081 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 613 | 1397822 | 1398016 | - | NZ_CP043404.1 | Bacillus safensis |
| 614 | 2276313 | 2276531 | - | NZ_CP032125.1 | Profundibacter amoris |
| 615 | 121610 | 121831 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 616 | 3503223 | 3503444 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 617 | 2062162 | 2062356 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 618 | 965910 | 966104 | - | NC_017449.1 | Francisella hispaniensis |
| 619 | 2095793 | 2096011 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
| 620 | 2738232 | 2738450 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 621 | 3256303 | 3256521 | - | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 622 | 1356183 | 1356443 | - | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 623 | 4617572 | 4617793 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 624 | 4788243 | 4788464 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 625 | 3652051 | 3652272 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 626 | 1031295 | 1031513 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 627 | 246854 | 247069 | + | NZ_CP029844.1 | Blattabacterium clevelandi |
| 628 | 2287069 | 2287287 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 629 | 2343048 | 2343266 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 630 | 2584840 | 2585058 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 631 | 2428912 | 2429130 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 632 | 2315306 | 2315500 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 633 | 191962 | 192156 | + | NZ_CP034118.1 | Staphylospora marina |
| 634 | 4200806 | 4201027 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 635 | 481740 | 481934 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 636 | 1571203 | 1571421 | - | NZ_CP009302.1 | Berryella intestinalis |
| 637 | 1194273 | 1194467 | - | NZ_CP021781.1 | Francisella adeliensis |
| 638 | 5213843 | 5214037 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 639 | 567339 | 567557 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 640 | 1920924 | 1921118 | - | NZ_CP046670.1 | Alteromonas mediterranea |
| 641 | 225606 | 225824 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 642 | 1773927 | 1774118 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 643 | 2002818 | 2003012 | - | NZ_CP008849.1 | Alteromonas australica |
| 644 | 624506 | 624709 | + | NZ_CP053562.1 | Thioclava electrotropha |
| 645 | 747104 | 747322 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 646 | 1166844 | 1167044 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 647 | 2562070 | 2562273 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 648 | 1545924 | 1546145 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 649 | 3669400 | 3669594 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 650 | 709507 | 709710 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 651 | 985676 | 985870 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 652 | 175251 | 175469 | + | NC_013170.1 | Cryptobacterium curtum DSM 15641 |
| 653 | 477205 | 477399 | + | NZ_CP012505.1 | Francisella persica ATCC VR-331 |
| 654 | 1467455 | 1467673 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 655 | 1674432 | 1674650 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 656 | 820401 | 820604 | + | NZ_CP019437.1 | Thioclava nitratireducens |
| 657 | 3260231 | 3260449 | + | NZ_CP034328.1 | Tabrizicola piscis |
| 658 | 1768301 | 1768495 | - | NZ_CP016604.1 | Otariodibacter oris |
| 659 | 1153303 | 1153539 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 660 | 6313541 | 6313759 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 661 | 1684756 | 1684959 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 662 | 1530770 | 1530988 | - | NC_015389.1 | Coriobacterium glomerans PW2 |
| 663 | 328206 | 328424 | + | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 664 | 2150232 | 2150435 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 665 | 1410752 | 1410955 | + | NZ_CP030918.1 | Paracoccus suum |
| 666 | 2895883 | 2896077 | + | NZ_CP041025.1 | Paremcibacter congregatus |
| 667 | 1800306 | 1800509 | - | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 668 | 1086998 | 1087219 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 669 | 390820 | 391038 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 670 | 465563 | 465781 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 671 | 407372 | 407590 | + | NZ_CP019688.1 | Corynebacterium glaucum |
| 672 | 3030128 | 3030349 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 673 | 637011 | 637214 | - | NC_004572.3 | Tropheryma whipplei str. Twist |
| 674 | 1298056 | 1298274 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 675 | 2682223 | 2682444 | - | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 676 | 411417 | 411638 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 677 | 1036889 | 1037110 | + | NZ_CP020715.1 | Cnuibacter physcomitrellae |
| 678 | 3487348 | 3487569 | - | NZ_CP071883.1 | Curtobacterium flaccumfaciens pv. flaccumfaciens |
| 679 | 861038 | 861259 | - | NZ_CP032630.1 | Protaetiibacter intestinalis |
| 680 | 3311319 | 3311540 | - | NZ_CP043661.1 | Kribbella qitaiheensis |
| 681 | 2055850 | 2056068 | - | NZ_LT906473.1 | Corynebacterium cystitidis |
| 682 | 6552070 | 6552291 | - | NC_013729.1 | Kribbella flavida DSM 17836 |
| 683 | 595972 | 596193 | + | NZ_CP013290.1 | Janibacter indicus |
| 684 | 2505831 | 2506034 | + | NZ_LN849456.1 | Devriesea agamarum |
| 685 | 214767 | 214988 | + | NZ_CP015772.1 | Niabella ginsenosidivorans |
| 686 | 1248642 | 1248863 | - | NZ_AP017457.1 | Aurantimicrobium minutum |
| 687 | 828028 | 828231 | - | NZ_CP038436.1 | Nocardioides seonyuensis |
| 688 | 2227173 | 2227394 | + | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036425.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03118.17 | 0.65 | 447 | 1627 | same-strand | Bacterial RNA polymerase, alpha chain C terminal domain |
| 2 | PF00416.24 | 0.64 | 440 | 172.0 | same-strand | Ribosomal protein S13/S18 |
| 3 | PF01193.26 | 0.65 | 445 | 1637 | same-strand | RNA polymerase Rpb3/Rpb11 dimerisation domain |
| 4 | PF01000.28 | 0.65 | 446 | 1636.5 | same-strand | RNA polymerase Rpb3/RpoA insert domain |
| 5 | PF00411.21 | 0.62 | 428 | 565.0 | same-strand | Ribosomal protein S11 |
++ More..