Result : A8F978
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative ribosomal protein L7Ae-like |
| NCBI Accession ID | CP000813.4 |
| Organism | Bacillus pumilus (strain SAFR-032) |
| Left | 127512 |
| Right | 127760 |
| Strand | + |
| Nucleotide Sequence | ATGTCTTATGATAAAGTATCACAGGCTCAATCCATTATTATTGGTACGAAGCAAACAGTAAAAGCTCTGAAACGAGATTCAGTAAAGGAAATCGTCGTAGCGAAAGATGCTGATCCTGCTTTAACAGCTAGTGTAACAAAACTAGCGCAAGAGAAGGGTGTAGACATTTTAGTGGTAGATTCCATGAAAAAGCTCGGCAAAGCCTGCGGAATTGAAGTTGGGGCAGCAGCTGTTGCCATTATGTTATAG |
| Sequence | MSYDKVSQAQSIIIGTKQTVKALKRDSVKEIVVAKDADPALTASVTKLAQEKGVDILVVDSMKKLGKACGIEVGAAAVAIML |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00600. Profile Description: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family. This RNA binding Pelota domain is at the C-terminus of a PRTase family. These PRTase+Pelota genes are found in the biosynthetic operon associated with the Ter stress-response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response. |
| Pubmed ID | 17895969 |
| Domain | CDD:412466 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A8F978 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 98
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 102547 | 102795 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 2 | 1416111 | 1416359 | - | NZ_CP043404.1 | Bacillus safensis |
| 3 | 1499041 | 1499289 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 4 | 99061 | 99309 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 265329 | 265577 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 136760 | 137008 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 7 | 128311 | 128559 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 8 | 1880118 | 1880366 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 9 | 129165 | 129413 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 10 | 129340 | 129588 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 11 | 160822 | 161070 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 129051 | 129299 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 13 | 129280 | 129528 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 14 | 130274 | 130522 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 15 | 3801018 | 3801266 | - | NZ_CP011937.1 | Bacillus velezensis |
| 16 | 1188353 | 1188601 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 17 | 116016 | 116264 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 18 | 132070 | 132318 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 19 | 125546 | 125794 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 20 | 1761922 | 1762170 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 21 | 244682 | 244930 | + | NZ_CP053989.1 | Niallia circulans |
| 22 | 141622 | 141870 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 23 | 66263 | 66511 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 24 | 2704504 | 2704752 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 25 | 140420 | 140668 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 26 | 163022 | 163270 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 27 | 123007 | 123255 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 28 | 4730163 | 4730411 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 29 | 2567959 | 2568207 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 30 | 2445764 | 2446012 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 31 | 4053498 | 4053746 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 32 | 122702 | 122950 | + | NZ_LS483476.1 | Lederbergia lentus |
| 33 | 2334472 | 2334720 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 34 | 130211 | 130459 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 35 | 3451457 | 3451705 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 36 | 132516 | 132767 | + | NZ_CP012024.1 | Bacillus smithii |
| 37 | 355596 | 355844 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 38 | 131529 | 131777 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 39 | 3443901 | 3444152 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 40 | 134095 | 134346 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 41 | 114527 | 114775 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 42 | 59489 | 59743 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 43 | 1957223 | 1957471 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 44 | 144131 | 144379 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 45 | 3258961 | 3259209 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 46 | 122537 | 122785 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 47 | 2816189 | 2816437 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 48 | 150550 | 150798 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 49 | 2273576 | 2273824 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 50 | 122406 | 122666 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 51 | 3087014 | 3087274 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 52 | 2549597 | 2549848 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 53 | 6398908 | 6399159 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 54 | 141468 | 141719 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 55 | 2315067 | 2315321 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 56 | 3106129 | 3106377 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 57 | 125616 | 125864 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 58 | 145755 | 146003 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 59 | 2583933 | 2584181 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 60 | 172415 | 172663 | + | NZ_CP034118.1 | Staphylospora marina |
| 61 | 135716 | 135964 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 62 | 187452 | 187706 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 63 | 1069598 | 1069852 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 64 | 260082 | 260336 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 65 | 1380259 | 1380513 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 66 | 1636871 | 1637119 | - | NZ_CP013661.2 | Planococcus kocurii |
| 67 | 296650 | 296904 | - | NZ_CP026363.1 | Brevibacillus agri |
| 68 | 62788 | 63039 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 69 | 125758 | 126006 | + | NZ_CP019401.1 | Planococcus faecalis |
| 70 | 172148 | 172399 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 71 | 488891 | 489139 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 72 | 4572350 | 4572601 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 73 | 187946 | 188194 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 74 | 3999097 | 3999333 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 75 | 178495 | 178749 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 76 | 138654 | 138905 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 77 | 1620095 | 1620343 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 78 | 153662 | 153910 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 79 | 141747 | 142007 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 80 | 148347 | 148607 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 81 | 239269 | 239520 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 82 | 2600377 | 2600628 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 83 | 4851776 | 4852027 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 84 | 323850 | 324098 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 85 | 3828915 | 3829127 | - | NZ_CP009687.1 | Clostridium aceticum |
| 86 | 133502 | 133753 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 87 | 2781810 | 2782067 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 88 | 3631699 | 3631950 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 89 | 8383036 | 8383287 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 90 | 3683476 | 3683715 | - | NZ_CP028842.1 | Clostridium botulinum |
| 91 | 3964601 | 3964840 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 92 | 4189492 | 4189725 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 93 | 1817637 | 1817885 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 94 | 4512650 | 4512898 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 95 | 231832 | 232080 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 96 | 2886691 | 2886930 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 97 | 230467 | 230709 | + | NC_008593.1 | Clostridium novyi NT |
| 98 | 1164737 | 1164967 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT603683.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00466.22 | 0.94 | 92 | 8806.5 | same-strand | Ribosomal protein L10 |
| 2 | PF00542.21 | 0.99 | 97 | 8384 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
| 3 | PF16320.7 | 0.99 | 97 | 8384 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
| 4 | PF05175.16 | 0.92 | 90 | 7685.0 | same-strand | Methyltransferase small domain |
| 5 | PF13649.8 | 0.82 | 80 | 7667.0 | same-strand | Methyltransferase domain |
| 6 | PF00562.30 | 1.0 | 98 | 3840.0 | same-strand | RNA polymerase Rpb2, domain 6 |
| 7 | PF04561.16 | 0.92 | 90 | 3840.0 | same-strand | RNA polymerase Rpb2, domain 2 |
| 8 | PF04563.17 | 1.0 | 98 | 3840.0 | same-strand | RNA polymerase beta subunit |
| 9 | PF04565.18 | 1.0 | 98 | 3840.0 | same-strand | RNA polymerase Rpb2, domain 3 |
| 10 | PF04560.22 | 1.0 | 98 | 3840.0 | same-strand | RNA polymerase Rpb2, domain 7 |
| 11 | PF10385.11 | 1.0 | 98 | 3840.0 | same-strand | RNA polymerase beta subunit external 1 domain |
| 12 | PF04997.14 | 1.0 | 98 | 139.0 | same-strand | RNA polymerase Rpb1, domain 1 |
| 13 | PF04998.19 | 0.83 | 81 | 139 | same-strand | RNA polymerase Rpb1, domain 5 |
| 14 | PF04983.20 | 1.0 | 98 | 139.0 | same-strand | RNA polymerase Rpb1, domain 3 |
| 15 | PF00164.27 | 0.99 | 97 | 105 | same-strand | Ribosomal protein S12/S23 |
| 16 | PF00177.23 | 1.0 | 98 | 573.0 | same-strand | Ribosomal protein S7p/S5e |
| 17 | PF00009.29 | 1.0 | 98 | 2221.0 | same-strand | Elongation factor Tu GTP binding domain |
| 18 | PF03764.20 | 1.0 | 98 | 1127.5 | same-strand | Elongation factor G, domain IV |
| 19 | PF14492.8 | 1.0 | 98 | 1127.5 | same-strand | Elongation Factor G, domain III |
| 20 | PF00679.26 | 1.0 | 98 | 1127.5 | same-strand | Elongation factor G C-terminus |
| 21 | PF03144.27 | 1.0 | 98 | 2221.0 | same-strand | Elongation factor Tu domain 2 |
| 22 | PF01926.25 | 1.0 | 98 | 3254.0 | same-strand | 50S ribosome-binding GTPase |
| 23 | PF03143.19 | 1.0 | 98 | 3299.0 | same-strand | Elongation factor Tu C-terminal domain |
| 24 | PF00338.24 | 0.6 | 59 | 4892 | same-strand | Ribosomal protein S10p/S20e |
++ More..