Protein Information |
Information Type | Description |
---|---|
Protein name | Protein ShdD (Phenolic acid decarboxylase subunit D) (PAD) |
NCBI Accession ID | AF128880.2 |
Organism | Sedimentibacter hydroxybenzoicus (Clostridium hydroxybenzoicum) |
Left | 3759 |
Right | 3965 |
Strand | + |
Nucleotide Sequence | ATGAAATGTCATAGATGTGGCTCGGATAATGTTAGAAAAATGGTAGATTCTCCTGTGGGAGATGCCTGGGAAGTTTATGTATGTGAAAAATGCTGTTATTCATGGCGTTCAACGGAGAATCCCGTTGTTATGGAGAAATTTAAATTAGATGATAATAAAATTGCAAATATGGGCGTAATACCGCCTATACCACCCTTGAAAAAATAG |
Sequence | MKCHRCGSDNVRKMVDSPVGDAWEVYVCEKCCYSWRSTENPVVMEKFKLDDNKIANMGVIPPIPPLKK |
Source of smORF | Swiss-Prot |
Function | Involved in the non-oxidative decarboxylation and detoxification of phenolic derivatives under anaerobic conditions, however the precise biochemical function of ShdD in metabolism of phenolic acid is unknown. {ECO:0000269|Pubmed:15979273, ECO:0000269|Pubmed:24193968}. |
Pubmed ID | 7744052 10438791 12054241 15979273 24193968 |
Domain | |
Functional Category | Others |
Uniprot ID | Q4R102 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1598682 | 1598888 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
2 | 1677222 | 1677428 | - | NC_014363.1 | Olsenella uli DSM 7084 |
3 | 2549785 | 2550012 | + | NZ_CP043998.1 | Clostridium diolis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01977.18 | 1.0 | 3 | 869.0 | same-strand | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase |
2 | PF03466.22 | 1.0 | 3 | 4037 | same-strand | LysR substrate binding domain |
3 | PF00126.29 | 1.0 | 3 | 4037 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |