Result : Q4QNL8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB1 (NTHi VapB1) |
| NCBI Accession ID | CP000057.2 |
| Organism | Haemophilus influenzae (strain 86-028NP) |
| Left | 419538 |
| Right | 419774 |
| Strand | + |
| Nucleotide Sequence | ATGCTTACTAAAGTGTTTCAAAGTGGTAACAGCCAAGCTGTTCGGATCCCGATGGACTTTCGTTTTGACGTCGATACCGTAGAAATTTTCCGAAAGGAAAATGGGGATGTGGTATTACGCCCAGTTTCTAAAAAAACAGATGATTTTCTTGCGTTATTTGAAGGATTTGATGAGACCTTTATTCAAGCACTTGAAGCGCGTGATGATTTACCGCCTCAGGAGCGAGAAAATTTATGA |
| Sequence | MLTKVFQSGNSQAVRIPMDFRFDVDTVEIFRKENGDVVLRPVSKKTDDFLALFEGFDETFIQALEARDDLPPQERENL |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system (Pubmed:25391136, Pubmed:27672196). Neutralizes the effect of cognate toxin VapC1 (Pubmed:25391136, Pubmed:27672196) but not non-cognate toxin VapC2 (Pubmed:27672196). {ECO:0000269|Pubmed:25391136, ECO:0000269|Pubmed:27672196}. |
| Pubmed ID | 15968074 17496075 25391136 27672196 |
| Domain | CDD:412624 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | Q4QNL8 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 741333 | 741569 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 696915 | 697151 | - | NZ_LR134378.1 | Lautropia mirabilis |
| 3 | 644030 | 644269 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 4 | 1697554 | 1697796 | + | NZ_CP059569.1 | Kingella oralis |
| 5 | 835018 | 835224 | + | NC_008789.1 | Halorhodospira halophila SL1 |
| 6 | 1524282 | 1524488 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 7 | 2336185 | 2336448 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 8 | 4664445 | 4664678 | + | NZ_AP014862.1 | Pseudomonas furukawaii |
| 9 | 3143311 | 3143541 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 10 | 418549 | 418779 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.9 | 9 | -3 | same-strand | PIN domain |
++ More..