Result : Q4QLV9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB2 (NTHi VapB2) |
| NCBI Accession ID | CP000057.2 |
| Organism | Haemophilus influenzae (strain 86-028NP) |
| Left | 1068244 |
| Right | 1068477 |
| Strand | - |
| Nucleotide Sequence | ATGATTGAAGCCTCTGTTTTTATGACTAATCGAAGTCAAGCTGTGCGTTTGCCCGCTGAAGTTCGCTTTTCTGAAGAAATCAAAAAATTATCGGTTCGTGTATCGGGCAGTGATCGGATTTTATCGCCTCTCAACCAATCTTGGGATAGTTTTTTCTTGAATGATCAAGCAGTTAGCGATGATTTTATGAATGAACGAGAAATTGCATTTCAACCAGAGCGTGAGGCTTTATAG |
| Sequence | MIEASVFMTNRSQAVRLPAEVRFSEEIKKLSVRVSGSDRILSPLNQSWDSFFLNDQAVSDDFMNEREIAFQPEREAL |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system (Pubmed:27672196). Neutralizes the effect of cognate toxin VapC2 but not non-cognate toxin VapC2 (Pubmed:27672196). {ECO:0000269|Pubmed:27672196}. |
| Pubmed ID | 15968074 27672196 |
| Domain | CDD:412624 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | Q4QLV9 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 46227 | 46460 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 47497 | 47730 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 230917 | 231150 | - | NZ_CP055305.1 | Mannheimia pernigra |
| 4 | 2010396 | 2010626 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 5 | 690779 | 690988 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 6 | 4314379 | 4314612 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 7 | 116585 | 116818 | - | NZ_CP028901.1 | Algicoccus marinus |
| 8 | 2869494 | 2869727 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 9 | 3131576 | 3131809 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 10 | 3160877 | 3161110 | - | NZ_LT906479.1 | Serratia ficaria |
| 11 | 2430227 | 2430460 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 12 | 804329 | 804562 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 13 | 519527 | 519760 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 14 | 4496973 | 4497209 | - | NZ_CP065640.1 | Serratia rubidaea |
| 15 | 887606 | 887839 | - | NZ_LT615228.1 | Polynucleobacter necessarius |
| 16 | 686848 | 687081 | + | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
| 17 | 1303707 | 1303940 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 18 | 2073741 | 2073974 | - | NZ_CP028339.1 | Thauera aromatica K172 |
| 19 | 236027 | 236266 | - | NZ_CP023276.1 | Polynucleobacter difficilis |
| 20 | 2602030 | 2602272 | + | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 21 | 3860158 | 3860391 | - | NZ_CP037951.1 | Parashewanella tropica |
| 22 | 3253819 | 3254010 | - | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 23 | 1941186 | 1941419 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 24 | 1547588 | 1547824 | + | NZ_CP014234.1 | Moraxella osloensis |
| 25 | 114037 | 114255 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 26 | 1713919 | 1714152 | + | NZ_CP007230.1 | Yersinia similis |
| 27 | 243898 | 244131 | - | NZ_LR134365.1 | Cardiobacterium hominis |
| 28 | 1826201 | 1826443 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 29 | 1134745 | 1134975 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 30 | 3546072 | 3546263 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 31 | 1939691 | 1939930 | - | NZ_CP011797.1 | Reinekea forsetii |
| 32 | 1983551 | 1983793 | - | NZ_AP020335.1 | Hydrogenovibrio marinus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.88 | 28 | 0 | same-strand | PIN domain |
++ More..