Result : A8F902
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0213 protein BPUM_0019 |
| NCBI Accession ID | CP000813.4 |
| Organism | Bacillus pumilus (strain SAFR-032) |
| Left | 45962 |
| Right | 46258 |
| Strand | + |
| Nucleotide Sequence | ATGGAGAAGCATAATCATTATTTCTATGTATTGAAATGTGCTGACGGCAGCCTATATGCAGGTTATACAAATGATTTACAAAAAAGACTGATGACCCACAATAGTGGGAAGGGAGCAAAGTATACAAGAGCCAGACGGCCAGTTGAGCTGTATTATCATGAATGTTTTGCAACCAAAAGAGAAGCGATGCAGCAAGAATATCGTTTCAAAACGTGGACACGAAAAAAGAAAGATCTTTATATAGAAGAAATGCGTATTGAAAAGGAGGCGACACATGAACACACAAAAAAGCTTTGA |
| Sequence | MEKHNHYFYVLKCADGSLYAGYTNDLQKRLMTHNSGKGAKYTRARRPVELYYHECFATKREAMQQEYRFKTWTRKKKDLYIEEMRIEKEATHEHTKKL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues. |
| Pubmed ID | 17895969 |
| Domain | CDD:417687 |
| Functional Category | Others |
| Uniprot ID | A8F902 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 141
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1502668 | 1502967 | - | NZ_CP043404.1 | Bacillus safensis |
| 2 | 1585718 | 1586017 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 3 | 22510 | 22809 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 4 | 3886494 | 3886793 | - | NZ_CP011937.1 | Bacillus velezensis |
| 5 | 44755 | 45054 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 6 | 43347 | 43646 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1965777 | 1966076 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 23905 | 24204 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 9 | 43334 | 43633 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 10 | 43322 | 43621 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 11 | 43647 | 43946 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 12 | 48121 | 48414 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 74740 | 75033 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 47843 | 48136 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 15 | 179483 | 179782 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 16 | 46652 | 46939 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 17 | 38154 | 38438 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 18 | 65351 | 65620 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 19 | 44881 | 45150 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 20 | 4641188 | 4641466 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 21 | 4640563 | 4640844 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 22 | 1716667 | 1716936 | - | NZ_CP013661.2 | Planococcus kocurii |
| 23 | 45936 | 46205 | + | NZ_CP019401.1 | Planococcus faecalis |
| 24 | 1805182 | 1805445 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 25 | 52477 | 52746 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 26 | 2483441 | 2483701 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 27 | 43815 | 44087 | + | NZ_CP016538.2 | Planococcus maritimus |
| 28 | 154785 | 155072 | + | NZ_CP053989.1 | Niallia circulans |
| 29 | 39627 | 39896 | + | NZ_CP016540.2 | Planococcus versutus |
| 30 | 4788903 | 4789166 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 31 | 43721 | 43993 | + | NZ_CP059540.1 | Planococcus maritimus |
| 32 | 46207 | 46476 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 33 | 2530063 | 2530323 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 34 | 3231772 | 3232044 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 35 | 890222 | 890509 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 36 | 45535 | 45822 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 37 | 43337 | 43609 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 38 | 2744255 | 2744509 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 39 | 39581 | 39871 | + | NC_011725.1 | Bacillus cereus B4264 |
| 40 | 1156925 | 1157215 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 41 | 43842 | 44117 | + | NZ_CP012024.1 | Bacillus smithii |
| 42 | 2788711 | 2788968 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 43 | 1144097 | 1144363 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 44 | 1829115 | 1829387 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 45 | 39291 | 39581 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 46 | 631980 | 632225 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 47 | 186321 | 186575 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 48 | 39893 | 40183 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 49 | 65874 | 66137 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 50 | 4655656 | 4655919 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 51 | 53415 | 53687 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 52 | 1851317 | 1851604 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 53 | 2048788 | 2049057 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 54 | 778270 | 778551 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 55 | 3843981 | 3844256 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 56 | 2155550 | 2155816 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 57 | 118955 | 119269 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 58 | 2986050 | 2986313 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 59 | 39276 | 39566 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 60 | 67694 | 67960 | + | NZ_CP017194.1 | Lactococcus carnosus |
| 61 | 39025 | 39306 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 62 | 5079982 | 5080272 | - | NZ_CP040336.1 | Bacillus luti |
| 63 | 944264 | 944578 | - | NZ_CP029476.1 | Lactobacillus apis |
| 64 | 39668 | 39958 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 65 | 1037396 | 1037647 | + | NZ_CP013237.1 | Streptococcus mutans |
| 66 | 1520929 | 1521180 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 67 | 783475 | 783741 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 68 | 1495078 | 1495320 | + | NC_012924.1 | Streptococcus suis SC84 |
| 69 | 31225 | 31515 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 70 | 5618040 | 5618285 | + | NZ_CP020953.1 | Clostridium drakei |
| 71 | 749037 | 749285 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 72 | 476305 | 476553 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 73 | 154500 | 154742 | + | NZ_CP043405.1 | Streptococcus ratti |
| 74 | 620456 | 620740 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 75 | 648338 | 648622 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 76 | 1725 | 1979 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 77 | 533011 | 533271 | - | NZ_LT906439.1 | Streptococcus merionis |
| 78 | 561931 | 562230 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 79 | 2388113 | 2388361 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 80 | 746316 | 746600 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 81 | 4771399 | 4771644 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 82 | 1456137 | 1456397 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 83 | 697465 | 697785 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 84 | 583646 | 583891 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 85 | 1020518 | 1020781 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 86 | 903440 | 903754 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 87 | 121048 | 121323 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 88 | 22618 | 22872 | - | NZ_CP030280.1 | Blautia argi |
| 89 | 850302 | 850577 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 90 | 2177895 | 2178173 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 91 | 2124578 | 2124838 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 92 | 46125 | 46403 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 93 | 472139 | 472387 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 94 | 1649933 | 1650172 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 95 | 460343 | 460591 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 96 | 395262 | 395522 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 97 | 914993 | 915244 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 98 | 498836 | 499123 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 99 | 1940714 | 1940968 | + | NZ_CP069188.1 | Haloterrigena salifodinae |
| 100 | 3866307 | 3866561 | - | NC_013743.1 | Haloterrigena turkmenica DSM 5511 |
| 101 | 1420593 | 1420841 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 102 | 1638635 | 1638889 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 103 | 553288 | 553539 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 104 | 2339117 | 2339365 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 105 | 6101290 | 6101550 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 106 | 66372 | 66638 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 107 | 1164331 | 1164594 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 108 | 1449062 | 1449340 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 109 | 690846 | 691106 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 110 | 1323457 | 1323714 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 111 | 4146863 | 4147144 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 112 | 790252 | 790500 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 113 | 2328254 | 2328505 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 114 | 1387149 | 1387430 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 115 | 1894565 | 1894807 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 116 | 54332 | 54577 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 117 | 893640 | 893894 | - | NZ_HG917868.1 | Clostridium bornimense |
| 118 | 1273971 | 1274222 | - | NZ_LR134293.1 | Streptococcus canis |
| 119 | 1159481 | 1159774 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 120 | 874791 | 875078 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 121 | 417164 | 417409 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 122 | 1107016 | 1107294 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 123 | 1919402 | 1919683 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 124 | 46365 | 46634 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 125 | 916901 | 917185 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 126 | 3469026 | 3469286 | - | NZ_CP030775.1 | Clostridium butyricum |
| 127 | 673391 | 673636 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 128 | 3625798 | 3626040 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 129 | 578875 | 579165 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 130 | 109847 | 110125 | + | NZ_LR134483.1 | Listeria grayi |
| 131 | 2659214 | 2659474 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 132 | 998993 | 999274 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 133 | 341097 | 341405 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 134 | 36420 | 36707 | + | NZ_LS483476.1 | Lederbergia lentus |
| 135 | 1441051 | 1441314 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 136 | 1387434 | 1387703 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 137 | 935672 | 935932 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 138 | 496793 | 497056 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 139 | 201354 | 201653 | + | NZ_CP013197.1 | Spiroplasma citri |
| 140 | 703334 | 703633 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 141 | 1513271 | 1513570 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 142 | 147335 | 147607 | + | NZ_LT906444.1 | Listeria welshimeri |
++ More..