Result : Q4QLV1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0270 protein NTHI1129 |
| NCBI Accession ID | CP000057.2 |
| Organism | Haemophilus influenzae (strain 86-028NP) |
| Left | 1074182 |
| Right | 1074433 |
| Strand | + |
| Nucleotide Sequence | ATGATTATTCCTTGGCAAGAACTGGAAGCAGAAACATTAGATAATATCGTAGAAAGCGTGATTTTACGCGAAGGAACCGATTACGGTATAGAAGAACTTTCACTCAACCAGAAAAAACAACTTTTACTGACTCAAATTCGCAATGGAATTGCGTTGATTGTATGGTCTGAATTACATGAATCCATTGACATCAAAAATAAAACGGAATTTTTGAAACAGGAATGTAAGGAGCAAGAATGTCAAATGAATTAA |
| Sequence | MIIPWQELEAETLDNIVESVILREGTDYGIEELSLNQKKQLLLTQIRNGIALIVWSELHESIDIKNKTEFLKQECKEQECQMN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01180. Profile Description: Uncharacterized protein family (UPF0270). hypothetical protein; Provisional |
| Pubmed ID | 15968074 |
| Domain | CDD:412782 |
| Functional Category | Others |
| Uniprot ID | Q4QLV1 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 182
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 40271 | 40522 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 41540 | 41791 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 1917951 | 1918202 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 1129347 | 1129565 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 200747 | 200962 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 6 | 5142 | 5360 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 7 | 2043133 | 2043351 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 8 | 497069 | 497287 | + | NZ_CP028926.1 | Pasteurella multocida |
| 9 | 715019 | 715243 | - | NZ_LR134167.1 | Avibacterium volantium |
| 10 | 1142803 | 1143021 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 11 | 253894 | 254121 | - | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 12 | 1536566 | 1536772 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 13 | 1916766 | 1916972 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 14 | 308154 | 308372 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 15 | 2243369 | 2243587 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 16 | 141369 | 141593 | - | NZ_CP018804.1 | Histophilus somni |
| 17 | 1662354 | 1662572 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 18 | 240615 | 240833 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 19 | 1660345 | 1660563 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 20 | 628354 | 628572 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 21 | 109798 | 110022 | - | NZ_CP016604.1 | Otariodibacter oris |
| 22 | 2006181 | 2006405 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
| 23 | 238650 | 238868 | - | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 24 | 191399 | 191617 | + | NZ_CP046531.1 | Mannheimia ovis |
| 25 | 292449 | 292670 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 26 | 238218 | 238436 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 27 | 629151 | 629369 | - | NZ_CP061280.1 | Mannheimia bovis |
| 28 | 1158256 | 1158474 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 29 | 5109584 | 5109802 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 30 | 497485 | 497703 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 31 | 4196838 | 4197056 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 32 | 3623633 | 3623854 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 33 | 381896 | 382114 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 34 | 948746 | 948964 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 35 | 3091832 | 3092053 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 36 | 4281146 | 4281382 | + | NZ_CP050150.1 | Hafnia alvei |
| 37 | 334305 | 334541 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 38 | 2725449 | 2725667 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 39 | 219188 | 219406 | - | NZ_LR134201.1 | Cedecea lapagei |
| 40 | 4477777 | 4477995 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 41 | 1463491 | 1463709 | + | NZ_CP053416.1 | Salmonella bongori |
| 42 | 3551978 | 3552202 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 43 | 1488731 | 1488955 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 44 | 442046 | 442264 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 45 | 4099814 | 4100047 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 46 | 4710235 | 4710453 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 47 | 4375930 | 4376148 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 48 | 2040605 | 2040823 | - | NZ_CP016180.1 | Pasteurella skyensis |
| 49 | 374515 | 374733 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 50 | 2874042 | 2874260 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 51 | 403709 | 403927 | - | NZ_CP041247.1 | Raoultella electrica |
| 52 | 1238650 | 1238871 | + | NZ_CP026364.1 | Proteus hauseri |
| 53 | 483502 | 483720 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 54 | 422443 | 422661 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 55 | 738395 | 738613 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 56 | 4904880 | 4905098 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 57 | 214559 | 214777 | - | NZ_CP023525.1 | Cedecea neteri |
| 58 | 420802 | 421020 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 59 | 4321088 | 4321306 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 60 | 2978390 | 2978608 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 61 | 493541 | 493777 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 62 | 4657242 | 4657460 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 63 | 3022583 | 3022801 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 64 | 4022771 | 4022989 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 65 | 522655 | 522873 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 66 | 2054025 | 2054243 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 67 | 2883578 | 2883796 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 68 | 3613706 | 3613924 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 69 | 4335541 | 4335759 | + | NC_015968.1 | Enterobacter soli |
| 70 | 5034804 | 5035037 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 71 | 4219967 | 4220185 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 72 | 4308831 | 4309049 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 73 | 4425082 | 4425300 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 74 | 3163654 | 3163866 | - | NZ_AP019657.1 | Vibrio ponticus |
| 75 | 4969401 | 4969634 | + | NZ_LR134494.1 | Serratia quinivorans |
| 76 | 3627112 | 3627330 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 77 | 1274495 | 1274713 | + | NZ_CP026047.1 | Raoultella planticola |
| 78 | 405922 | 406140 | - | NZ_CP050508.1 | Raoultella terrigena |
| 79 | 3531435 | 3531653 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 80 | 4405388 | 4405624 | + | NZ_CP032487.1 | Yersinia hibernica |
| 81 | 4918860 | 4919093 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 82 | 2094201 | 2094419 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 83 | 433184 | 433402 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 84 | 460263 | 460484 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 85 | 326805 | 327014 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 86 | 293202 | 293420 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 87 | 1212208 | 1212429 | + | NZ_CP019706.1 | Pantoea alhagi |
| 88 | 403998 | 404216 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 89 | 4887012 | 4887230 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 90 | 413539 | 413757 | - | NZ_CP054254.1 | Klebsiella variicola |
| 91 | 736390 | 736602 | - | NC_013456.1 | Vibrio antiquarius |
| 92 | 3806397 | 3806615 | - | NZ_CP038469.1 | Citrobacter tructae |
| 93 | 1160343 | 1160579 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 94 | 4202576 | 4202794 | - | NZ_CP028271.1 | Mixta intestinalis |
| 95 | 452537 | 452773 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 96 | 4708884 | 4709120 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 97 | 102686 | 102904 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 98 | 4261001 | 4261237 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 99 | 4432675 | 4432911 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 100 | 1518589 | 1518807 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 101 | 2501962 | 2502198 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 102 | 297963 | 298178 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 103 | 3972293 | 3972511 | + | NZ_LR134340.1 | Escherichia marmotae |
| 104 | 566916 | 567131 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 105 | 351944 | 352192 | - | NZ_LS483470.1 | Leminorella richardii |
| 106 | 4167022 | 4167270 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 107 | 2982910 | 2983146 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 108 | 2480969 | 2481175 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 109 | 2110996 | 2111232 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 110 | 3235385 | 3235621 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 111 | 2872252 | 2872470 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 112 | 3116367 | 3116591 | + | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 113 | 429053 | 429271 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 114 | 4779890 | 4780126 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 115 | 1541066 | 1541302 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 116 | 3453427 | 3453645 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 117 | 3484218 | 3484436 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 118 | 3445122 | 3445340 | + | NZ_AP014857.1 | Escherichia albertii |
| 119 | 4204252 | 4204470 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 120 | 4423938 | 4424174 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 121 | 3352690 | 3352938 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 122 | 404612 | 404830 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 123 | 285190 | 285441 | - | NZ_LR134531.1 | Pragia fontium |
| 124 | 3883363 | 3883581 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 125 | 2615070 | 2615306 | + | NZ_CP009787.1 | Yersinia rohdei |
| 126 | 2472592 | 2472810 | + | NZ_CP049115.1 | Pantoea stewartii |
| 127 | 113162 | 113398 | - | NZ_CP046293.1 | Yersinia intermedia |
| 128 | 2508895 | 2509137 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 129 | 588587 | 588808 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 130 | 1636627 | 1636845 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 131 | 222011 | 222235 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 132 | 3514314 | 3514526 | + | NZ_CP009467.1 | Vibrio harveyi |
| 133 | 292967 | 293185 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 134 | 129155 | 129391 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 135 | 343206 | 343424 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 136 | 2736429 | 2736641 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 137 | 2390401 | 2390619 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 138 | 310522 | 310734 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 139 | 308542 | 308778 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 140 | 356215 | 356433 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 141 | 772094 | 772324 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 142 | 3998126 | 3998371 | - | NZ_CP067057.1 | Rahnella aceris |
| 143 | 3552606 | 3552824 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 144 | 3399389 | 3399613 | + | NZ_CP017689.1 | Thalassotalea crassostreae |
| 145 | 284513 | 284749 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 146 | 1362432 | 1362665 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 147 | 461112 | 461330 | + | NZ_CP029736.1 | Providencia rettgeri |
| 148 | 3508053 | 3508271 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 149 | 4222589 | 4222825 | + | NZ_CP025799.1 | Dickeya zeae |
| 150 | 2940151 | 2940363 | + | NZ_CP030788.1 | Vibrio campbellii |
| 151 | 2140311 | 2140523 | - | NZ_CP019959.1 | Vibrio owensii |
| 152 | 469883 | 470119 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 153 | 234731 | 234943 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 154 | 351722 | 351952 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 155 | 294058 | 294288 | - | NZ_CP065534.1 | Lonsdalea populi |
| 156 | 2799764 | 2799982 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 157 | 2274780 | 2274998 | + | NZ_CP033744.1 | Citrobacter freundii |
| 158 | 4871740 | 4871973 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 159 | 45778 | 45996 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 160 | 1929541 | 1929753 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
| 161 | 3689845 | 3690063 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 162 | 1291559 | 1291795 | + | NZ_CP007230.1 | Yersinia similis |
| 163 | 1949024 | 1949248 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 164 | 448486 | 448722 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 165 | 432461 | 432679 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 166 | 277264 | 277476 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 167 | 2561660 | 2561872 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 168 | 3935240 | 3935458 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 169 | 1350996 | 1351229 | + | NZ_CP011254.1 | Serratia fonticola |
| 170 | 3020293 | 3020532 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 171 | 336951 | 337169 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 172 | 356046 | 356264 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 173 | 4179476 | 4179694 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 174 | 3181462 | 3181674 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 175 | 397447 | 397665 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 176 | 4391351 | 4391587 | + | NZ_CP043727.1 | Yersinia canariae |
| 177 | 3638654 | 3638872 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 178 | 432690 | 432908 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 179 | 442828 | 443046 | - | NZ_CP038853.1 | Pantoea vagans |
| 180 | 420613 | 420849 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 181 | 284988 | 285206 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 182 | 4020488 | 4020718 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 183 | 4354302 | 4354535 | - | NZ_CP046670.1 | Alteromonas mediterranea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP020388.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00027.31 | 0.93 | 169 | 1683.0 | same-strand | Cyclic nucleotide-binding domain |
| 2 | PF13545.8 | 0.93 | 169 | 1683.0 | same-strand | Crp-like helix-turn-helix domain |
| 3 | PF00325.22 | 0.93 | 169 | 1683.0 | same-strand | Bacterial regulatory proteins, crp family |
| 4 | PF00485.20 | 0.76 | 138 | 73 | same-strand | Phosphoribulokinase / Uridine kinase family |
| 5 | PF00561.22 | 0.77 | 140 | -3 | same-strand | alpha/beta hydrolase fold |
| 6 | PF12146.10 | 0.76 | 139 | -3.0 | same-strand | Serine aminopeptidase, S33 |
++ More..