Result : Q4L660
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein SH1556 |
| NCBI Accession ID | AP006716.1 |
| Organism | Staphylococcus haemolyticus (strain JCSC1435) |
| Left | 1601351 |
| Right | 1601650 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATTAAACTAACAGATCAAGCTGTAGAATGGTTTAAAGATGAACTAGACTTACCTGAAAATAACAAAGTTTTACAGTTTTACGTTCGCTATGGTGGTGAATTTCAACTTAAACAAGGTTTCAGTCCTGCCTTTCGCGTTGAACCAAGAGAAGATGTAGAAATTGGTTACGAAGAAAATTATAATGATTTGATATTAGTCGTTTCAGAAGAAGATCTATGGTATTTTGAGGATAATGAAGTCCTCGTTGAAAAAGTAGATCATGATGATGAAATTGCCTATTCTAAATTGAAGTAA |
| Sequence | MKIKLTDQAVEWFKDELDLPENNKVLQFYVRYGGEFQLKQGFSPAFRVEPREDVEIGYEENYNDLILVVSEEDLWYFEDNEVLVEKVDHDDEIAYSKLK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00400. Profile Description: Iron-sulphur cluster biosynthesis. Proteins in this subfamily appear to be associated with the process of FeS-cluster assembly. The HesB proteins are associated with the nif gene cluster and the Rhizobium gene IscN has been shown to be required for nitrogen fixation. Nitrogenase includes multiple FeS clusters and many genes for their assembly. The E. coli SufA protein is associated with SufS, a NifS homolog and SufD which are involved in the FeS cluster assembly of the FhnF protein. The Azotobacter protein IscA (homologs of which are also found in E.coli) is associated which IscS, another NifS homolog and IscU, a nifU homolog as well as other factors consistent with a role in FeS cluster chemistry. A homolog from Geobacter contains a selenocysteine in place of an otherwise invariant cysteine, further suggesting a role in redox chemistry. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other] |
| Pubmed ID | 16237012 |
| Domain | CDD:412359 |
| Functional Category | Others |
| Uniprot ID | Q4L660 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1016540 | 1016839 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 2 | 2190670 | 2190969 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 3 | 1484134 | 1484430 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 4 | 1601130 | 1601426 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 5 | 2502979 | 2503275 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 1290720 | 1291016 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 7 | 432020 | 432316 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 8 | 1391602 | 1391898 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 9 | 666424 | 666720 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 10 | 1327631 | 1327927 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 11 | 1538162 | 1538458 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 12 | 1506347 | 1506643 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 13 | 1570148 | 1570444 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 14 | 786828 | 787124 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 15 | 1480419 | 1480715 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 16 | 309236 | 309532 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 17 | 1221308 | 1221604 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 18 | 1143987 | 1144292 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 19 | 1336998 | 1337294 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 20 | 1833231 | 1833539 | - | NZ_CP027770.1 | Staphylococcus felis |
| 21 | 2362623 | 2362928 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 22 | 1645466 | 1645783 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 23 | 1002101 | 1002400 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 24 | 1283870 | 1284172 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 25 | 1554790 | 1555089 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 26 | 1448675 | 1448992 | - | NZ_CP033460.1 | Staphylococcus debuckii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013911.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13476.8 | 0.73 | 19 | 6184 | opposite-strand | AAA domain |
| 2 | PF01741.20 | 1.0 | 26 | 5647.5 | same-strand | Large-conductance mechanosensitive channel, MscL |
| 3 | PF02028.19 | 1.0 | 26 | 3801.0 | opposite-strand | BCCT, betaine/carnitine/choline family transporter |
| 4 | PF00330.22 | 1.0 | 26 | 749.0 | opposite-strand | Aconitase family (aconitate hydratase) |
| 5 | PF00694.21 | 1.0 | 26 | 749.0 | opposite-strand | Aconitase C-terminal domain |
| 6 | PF03061.24 | 1.0 | 26 | 113.0 | opposite-strand | Thioesterase superfamily |
| 7 | PF13279.8 | 1.0 | 26 | 113.0 | opposite-strand | Thioesterase-like superfamily |
| 8 | PF02660.17 | 1.0 | 26 | 220.5 | same-strand | Glycerol-3-phosphate acyltransferase |
| 9 | PF00204.27 | 1.0 | 26 | 1050.0 | opposite-strand | DNA gyrase B |
| 10 | PF00986.23 | 1.0 | 26 | 1050.0 | opposite-strand | DNA gyrase B subunit, carboxyl terminus |
| 11 | PF02518.28 | 1.0 | 26 | 1050.0 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 12 | PF01751.24 | 1.0 | 26 | 1050.0 | opposite-strand | Toprim domain |
| 13 | PF00521.22 | 1.0 | 26 | 3047.0 | opposite-strand | DNA gyrase/topoisomerase IV, subunit A |
| 14 | PF03989.15 | 0.88 | 23 | 3034 | opposite-strand | DNA gyrase C-terminal domain, beta-propeller |
| 15 | PF01235.19 | 1.0 | 26 | 5666.5 | opposite-strand | Sodium:alanine symporter family |
| 16 | PF00874.22 | 0.88 | 23 | 7321 | opposite-strand | PRD domain |
| 17 | PF03123.17 | 0.88 | 23 | 7321 | opposite-strand | CAT RNA binding domain |
++ More..