Result : Q4L5M5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antibacterial protein 1 homolog |
| NCBI Accession ID | AP006716.1 |
| Organism | Staphylococcus haemolyticus (strain JCSC1435) |
| Left | 1804998 |
| Right | 1805132 |
| Strand | - |
| Nucleotide Sequence | ATGCAAAAATTAGCAGAAGCAATTGCAGCAGCAGTACAAGCAGGACAAGATAAAGACTGGGGTAAAATGGGTACAAGCATCGTAGGTATCGTAGAAAACGGAATCAGTGTTTTAGGTAAAATTTTCGGCTTCTAA |
| Sequence | MQKLAEAIAAAVQAGQDKDWGKMGTSIVGIVENGISVLGKIFGF |
| Source of smORF | Swiss-Prot |
| Function | Has hemolytic activity and also inhibits the growth of gonococci. {ECO:0000250}. |
| Pubmed ID | 16237012 |
| Domain | CDD:398890 |
| Functional Category | Antimicrobial |
| Uniprot ID | Q4L5M5 |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 819126 | 819260 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 2 | 818354 | 818488 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 3 | 818737 | 818871 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 4 | 818928 | 819062 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 5 | 818548 | 818682 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 6 | 468369 | 468503 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 7 | 468554 | 468688 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 8 | 468179 | 468313 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 9 | 468001 | 468135 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 10 | 1802547 | 1802681 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 11 | 1802176 | 1802310 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 12 | 1802359 | 1802493 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 13 | 1802717 | 1802851 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 14 | 1735573 | 1735707 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 15 | 1735383 | 1735517 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 16 | 1641745 | 1641879 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 17 | 1641548 | 1641682 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 18 | 1641353 | 1641487 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 19 | 2305256 | 2305390 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 20 | 2305442 | 2305576 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 21 | 2305086 | 2305220 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 22 | 1675914 | 1676048 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 23 | 1675736 | 1675870 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 24 | 1675549 | 1675683 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 25 | 1675362 | 1675496 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 26 | 1676084 | 1676218 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 27 | 162430 | 162564 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 28 | 162776 | 162910 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 29 | 162607 | 162741 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 30 | 162953 | 163087 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 31 | 163128 | 163262 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 32 | 1114779 | 1114913 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 33 | 1114603 | 1114737 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 34 | 1159146 | 1159280 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 35 | 1158955 | 1159089 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 36 | 1088634 | 1088768 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 37 | 1088443 | 1088577 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 38 | 1220053 | 1220190 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 39 | 1686111 | 1686245 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 40 | 1783429 | 1783563 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 41 | 1782708 | 1782842 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 42 | 1783069 | 1783203 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 43 | 1783248 | 1783382 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 44 | 1782884 | 1783018 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 45 | 998795 | 998929 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 46 | 998614 | 998748 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 47 | 1532474 | 1532608 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 48 | 1532648 | 1532782 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 49 | 962517 | 962651 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 50 | 962339 | 962473 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 51 | 1895475 | 1895606 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013911.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05480.13 | 0.94 | 17 | 64 | same-strand | Phenol-soluble modulin beta protein |
| 2 | PF13419.8 | 0.83 | 15 | 324 | same-strand | Haloacid dehalogenase-like hydrolase |
| 3 | PF00702.28 | 0.61 | 11 | 325.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 4 | PF13242.8 | 0.61 | 11 | 309 | same-strand | HAD-hyrolase-like |
| 5 | PF10079.11 | 0.89 | 16 | 1717.5 | same-strand | Bacillithiol biosynthesis BshC |
| 6 | PF02381.20 | 0.89 | 16 | 3384 | same-strand | MraZ protein, putative antitoxin-like |
| 7 | PF01795.21 | 0.67 | 12 | 3737.5 | same-strand | MraW methylase family |
++ More..