Result : Q4L562
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable quinol oxidase subunit 4 (EC 1.10.3.-) (Quinol oxidase polypeptide IV) |
| NCBI Accession ID | AP006716.1 |
| Organism | Staphylococcus haemolyticus (strain JCSC1435) |
| Left | 1949444 |
| Right | 1949734 |
| Strand | + |
| Nucleotide Sequence | ATGAATACAATCGTAAAACATACAGTCGGCTTTATTGCCTCAATCGTCTTGACGTTATTAGCAGTTTTCGTAACTCTATACACAAACATGACATTCCATGCTAAAACAACAATCATCTTTGGCTTTGCTTTTATTCAAGCTGCAGTTCAATTATTAATGTTCATGCACTTAACTGAAGGAAAAGATGGTCAAGTACAATCGTTCAAAGTTATCTTTGCGATTATCATCACATTAGTGACTGTTATTGGTACGTATTGGGTTATGCAAGGTGGACATTCTCACCACTTATAA |
| Sequence | MNTIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKTTIIFGFAFIQAAVQLLMFMHLTEGKDGQVQSFKVIFAIIITLVTVIGTYWVMQGGHSHHL |
| Source of smORF | Swiss-Prot |
| Function | Catalyzes quinol oxidation with the concomitant reduction of oxygen to water. {ECO:0000250}. |
| Pubmed ID | 16237012 |
| Domain | CDD:412789 |
| Functional Category | Others |
| Uniprot ID | Q4L562 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 724611 | 724901 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 2 | 720910 | 721200 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 3 | 1834031 | 1834321 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 4 | 1542768 | 1543058 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 5 | 2215979 | 2216269 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 6 | 364312 | 364602 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 7 | 1764363 | 1764653 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 8 | 258925 | 259215 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 9 | 1954923 | 1955213 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 10 | 27245 | 27535 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 11 | 1963132 | 1963422 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 12 | 1792305 | 1792595 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 13 | 1099270 | 1099560 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 14 | 1884165 | 1884455 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 15 | 1102337 | 1102627 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 16 | 860251 | 860541 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 17 | 1043396 | 1043686 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 18 | 972596 | 972886 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 19 | 2015234 | 2015524 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 20 | 804500 | 804790 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 21 | 1625156 | 1625446 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 22 | 1021994 | 1022284 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 23 | 1858509 | 1858799 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 24 | 655629 | 655919 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 25 | 1795119 | 1795409 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 26 | 685243 | 685533 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 27 | 507499 | 507735 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 28 | 1741341 | 1741577 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 29 | 1518569 | 1518859 | - | NZ_CP027770.1 | Staphylococcus felis |
| 30 | 1654208 | 1654501 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 31 | 19915 | 20247 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 32 | 75234 | 75566 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 33 | 20011 | 20256 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 34 | 19692 | 19937 | + | NZ_LT906444.1 | Listeria welshimeri |
| 35 | 21804 | 22043 | + | NZ_LR134483.1 | Listeria grayi |
| 36 | 2912327 | 2912611 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 37 | 3370303 | 3370632 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 38 | 3863687 | 3863956 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 39 | 4069057 | 4069326 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013911.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00115.22 | 1.0 | 39 | 592 | same-strand | Cytochrome C and Quinol oxidase polypeptide I |
| 2 | PF02790.17 | 0.9 | 35 | 2580 | same-strand | Cytochrome C oxidase subunit II, transmembrane domain |
| 3 | PF16403.7 | 0.74 | 29 | 4009 | same-strand | Domain of unknown function (DUF5011) |
++ More..