| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antiporter subunit mnhF2 (Mrp complex subunit F2) (Putative NADH-ubiquinone oxidoreductase subunit mnhF2) |
| NCBI Accession ID | AP006716.1 |
| Organism | Staphylococcus haemolyticus (strain JCSC1435) |
| Left | 2305599 |
| Right | 2305901 |
| Strand | - |
| Nucleotide Sequence | ATGATTGAAACGCTCACGAATTTTTTTATTACAAGTGCATTAGTATTATTTGGCATAGCGTTCATAATTGGATTATTCCGTTTAATCAAAGGACCTACTACAGCTGATAGGGTTGTGGCGTTCGATGCTTCCAGTGCTGTCATCATGTGCATTATAGGTATAGTTAGTGTTATTTATAATACTGTTTCATTCCTTGATTCCATAATGCTTGTTGCAATTATTTCATTTGTAAGTTCTGTATCTATTTCTAGATTTATAGGGGGAGGTCGAGTATTCAATGGCACAAATAAACGAAATCATTGA |
| Sequence | MIETLTNFFITSALVLFGIAFIIGLFRLIKGPTTADRVVAFDASSAVIMCIIGIVSVIYNTVSFLDSIMLVAIISFVSSVSISRFIGGGRVFNGTNKRNH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09154. Profile Description: Multiple resistance and pH regulation protein F (MrpF / PhaF). putative monovalent cation/H+ antiporter subunit F; Reviewed |
| Pubmed ID | 16237012 |
| Domain | CDD:415596 |
| Functional Category | Others |
| Uniprot ID | Q4L448 |
| ORF Length (Amino Acid) | 100 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 352606 | 352908 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 2 | 585505 | 585807 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 3 | 311809 | 312111 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 4 | 1960710 | 1960952 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 5 | 2229921 | 2230223 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 6 | 1115394 | 1115696 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 7 | 2090554 | 2090856 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 8 | 1832679 | 1832981 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 9 | 2300572 | 2300874 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 10 | 2142508 | 2142810 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 11 | 640514 | 640816 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 12 | 327189 | 327491 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 13 | 2174056 | 2174358 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 14 | 2437256 | 2437558 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 15 | 1215125 | 1215427 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 16 | 2150356 | 2150658 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 17 | 640900 | 641202 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 18 | 2137493 | 2137795 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 19 | 1450164 | 1450466 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 20 | 620050 | 620352 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 21 | 2175109 | 2175411 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 22 | 322180 | 322470 | - | NZ_CP027770.1 | Staphylococcus felis |
| 23 | 498227 | 498529 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 24 | 489950 | 490246 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 25 | 1877879 | 1878172 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 26 | 272076 | 272369 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 27 | 352472 | 352765 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00361.22 | 1.0 | 27 | 536 | same-strand | Proton-conducting membrane transporter |
| 2 | PF13244.8 | 1.0 | 27 | 2724 | same-strand | Domain of unknown function (DUF4040) |
| 3 | PF00662.22 | 0.93 | 25 | 2724 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 4 | PF04039.15 | 1.0 | 27 | 2312 | same-strand | Domain related to MnhB subunit of Na+/H+ antiporter |
| 5 | PF00420.26 | 1.0 | 27 | 1971 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
| 6 | PF01899.18 | 1.0 | 27 | -3 | same-strand | Na+/H+ ion antiporter subunit |
| 7 | PF03334.16 | 1.0 | 27 | -25 | same-strand | Na+/H+ antiporter subunit |
| 8 | PF00999.23 | 0.7 | 19 | 839 | same-strand | Sodium/hydrogen exchanger family |
| 9 | PF01297.19 | 0.81 | 22 | 3279.5 | opposite-strand | Zinc-uptake complex component A periplasmic |
| 10 | PF00950.19 | 0.81 | 22 | 4202.5 | opposite-strand | ABC 3 transport family |
| 11 | PF00005.29 | 0.81 | 22 | 5056.0 | opposite-strand | ABC transporter |