Result : Q4L2X3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Accessory secretory protein Asp4 (Orf5) |
| NCBI Accession ID | AY028381.5 |
| Organism | Streptococcus gordonii |
| Left | 23839 |
| Right | 24021 |
| Strand | + |
| Nucleotide Sequence | ATGGCTAAAAAAGATTTATTTCATAAGGATATTGAGGGGCGGTTAGATGAGCTAAAGCATGGCAAGCCCAAGAAAGAAAAGGCCAGCTTGGGTGAAAATCTCAACAAGATCTTTGTCATCGCTTTGGGCTTGATGATCTTGATTGGCCTGATTTTTACATTGATTGGAGCCTTGAGGAAATAA |
| Sequence | MAKKDLFHKDIEGRLDELKHGKPKKEKASLGENLNKIFVIALGLMILIGLIFTLIGALRK |
| Source of smORF | Swiss-Prot |
| Function | Part of the accessory SecA2/SecY2 system specifically required to export GspB, a serine-rich repeat cell wall protein encoded upstream in the same operon. {ECO:0000269|Pubmed:15901716}. |
| Pubmed ID | 15901716 |
| Domain | CDD:407201 |
| Functional Category | Others |
| Uniprot ID | Q4L2X3 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1009331 | 1009513 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 2 | 1334595 | 1334774 | - | NZ_LR134275.1 | Streptococcus vestibularis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR594049.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16929.7 | 1.0 | 2 | 5696.0 | same-strand | Accessory Sec system GspB-transporter |
| 2 | PF15432.8 | 1.0 | 2 | 5233.5 | same-strand | Accessory Sec secretory system ASP3 |
| 3 | PF07517.16 | 1.0 | 2 | 2862.5 | same-strand | SecA DEAD-like domain |
| 4 | PF01043.22 | 1.0 | 2 | 2862.5 | same-strand | SecA preprotein cross-linking domain |
| 5 | PF07516.15 | 1.0 | 2 | 2862.5 | same-strand | SecA Wing and Scaffold domain |
| 6 | PF13692.8 | 1.0 | 2 | 1335.5 | same-strand | Glycosyl transferases group 1 |
| 7 | PF17000.7 | 1.0 | 2 | 3.5 | same-strand | Accessory secretory protein Sec, Asp5 |
++ More..