Result : Q4KJL7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CP000076.1 |
| Organism | Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) |
| Left | 487213 |
| Right | 487494 |
| Strand | - |
| Nucleotide Sequence | ATGGGCATTTTTGACTGGAAACACTGGATCGTCATCCTGGTGGTCGTGGTACTGGTATTCGGCACCAAGAAGCTCAAGAACCTGGGCACCGACGTCGGCGAATCGATCAAGGGCTTTCGCAAGGCCATGAATGACGACGAAAAGCCTGCCGAACCCGTGGTCCCGCCAGCGGCGCAGCCTGTGCCACCGGTTCAGCCGCAGCAGAGCGCGCCGTTGAACCAGCCGCACACCATCGATGTGCAGGCGCAGAAAGTCGAAGAGCCGACCCGCAAAGACTCGTGA |
| Sequence | MGIFDWKHWIVILVVVVLVFGTKKLKNLGTDVGESIKGFRKAMNDDEKPAEPVVPPAAQPVPPVQPQQSAPLNQPHTIDVQAQKVEEPTRKDS |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 15980861 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q4KJL7 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 490814 | 491095 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 2 | 462062 | 462340 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 3 | 4581429 | 4581707 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 4 | 4199151 | 4199429 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 5 | 349350 | 349628 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 6 | 3701925 | 3702212 | + | NZ_CP048810.1 | Pseudomonas bijieensis |
| 7 | 488064 | 488351 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 8 | 429674 | 429961 | - | NZ_CP035088.1 | Pseudomonas viciae |
| 9 | 4944274 | 4944552 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 10 | 459639 | 459905 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 11 | 432112 | 432390 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 12 | 421276 | 421554 | - | NZ_CP027723.1 | Pseudomonas orientalis |
| 13 | 414056 | 414334 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 14 | 656777 | 657055 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 15 | 457498 | 457776 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 16 | 420802 | 421080 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 17 | 3235575 | 3235835 | + | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 18 | 3496153 | 3496431 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 19 | 485491 | 485763 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 20 | 5631588 | 5631869 | + | NZ_CP070503.1 | Pseudomonas atacamensis |
| 21 | 6146614 | 6146892 | + | NZ_CP012400.2 | Pseudomonas yamanorum |
| 22 | 3955438 | 3955725 | - | NZ_CP014262.1 | Pseudomonas corrugata |
| 23 | 469055 | 469333 | - | NZ_CP029608.1 | Pseudomonas kribbensis |
| 24 | 453043 | 453321 | - | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 25 | 461618 | 461896 | - | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 26 | 299371 | 299649 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 27 | 5673791 | 5674054 | + | NZ_AP022642.1 | Pseudomonas otitidis |
| 28 | 5434555 | 5434830 | + | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 29 | 5706552 | 5706800 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 30 | 5759096 | 5759359 | + | NZ_AP014862.1 | Pseudomonas furukawaii |
| 31 | 5620405 | 5620668 | + | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 32 | 551587 | 551856 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 33 | 98710 | 98958 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 34 | 5347122 | 5347391 | + | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 35 | 536207 | 536443 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 36 | 5635364 | 5635621 | + | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 37 | 427830 | 428105 | - | NZ_CP068034.2 | Pseudomonas syringae |
| 38 | 341858 | 342133 | - | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 39 | 5864849 | 5865124 | + | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 40 | 5474538 | 5474825 | + | NZ_CP022562.1 | Pseudomonas monteilii |
| 41 | 4425695 | 4425967 | + | NZ_CP009365.1 | Pseudomonas soli |
| 42 | 631751 | 631996 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 43 | 5390511 | 5390783 | + | NC_008027.1 | Pseudomonas entomophila L48 |
| 44 | 481027 | 481299 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 45 | 5754593 | 5754865 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 46 | 3207079 | 3207366 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 47 | 4614125 | 4614382 | + | NC_012560.1 | Azotobacter vinelandii DJ |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS999205.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16591.7 | 0.89 | 41 | 2119 | same-strand | Helical bimodular sensor domain |
| 2 | PF00015.23 | 0.96 | 44 | 2136 | same-strand | Methyl-accepting chemotaxis protein (MCP) signalling domain |
| 3 | PF00672.27 | 0.96 | 44 | 2127.5 | same-strand | HAMP domain |
| 4 | PF04452.16 | 1.0 | 46 | 1231.0 | same-strand | RNA methyltransferase |
| 5 | PF00902.20 | 1.0 | 46 | 435 | same-strand | Sec-independent protein translocase protein (TatC) |
| 6 | PF01503.19 | 0.98 | 45 | 26 | same-strand | Phosphoribosyl-ATP pyrophosphohydrolase |
| 7 | PF01502.20 | 1.0 | 46 | 358.5 | same-strand | Phosphoribosyl-AMP cyclohydrolase |
| 8 | PF03109.18 | 1.0 | 46 | 833.0 | same-strand | ABC1 atypical kinase-like domain |
| 9 | PF02036.19 | 1.0 | 46 | 2435.0 | same-strand | SCP-2 sterol transfer family |
| 10 | PF01209.20 | 1.0 | 46 | 3057.0 | same-strand | ubiE/COQ5 methyltransferase family |
| 11 | PF13649.8 | 1.0 | 46 | 3057.0 | same-strand | Methyltransferase domain |
| 12 | PF08241.14 | 1.0 | 46 | 3057.0 | same-strand | Methyltransferase domain |
| 13 | PF13489.8 | 1.0 | 46 | 3057.0 | same-strand | Methyltransferase domain |
| 14 | PF08242.14 | 1.0 | 46 | 3057.0 | same-strand | Methyltransferase domain |
++ More..