Result : A8F4E8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000812.1 |
| Organism | Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) (Thermotoga lettingae) |
| Left | 490871 |
| Right | 491140 |
| Strand | - |
| Nucleotide Sequence | ATGCAGGCACTTTTTATAAAGATAAGTGGTCGTGTCCATGGAGTTGGTTTCAGATATTTTACATATAAATTAGCAAATAAAATGAAAATTAAAGGATATGTTAGAAACGCGGAAGATGGATCAGTAGAGATTCACGCTGAAGCACCCGAAGAAATCCTCGTAGAGTTTCTCAAGGCAGTGTCCATCGGACCACCGATGGCTACCGTAATTAGTGTAAAATACGAAAGAGTGGCCGGACAAAATTTCACATCATTTGACATTGTGCCGTGA |
| Sequence | MQALFIKISGRVHGVGFRYFTYKLANKMKIKGYVRNAEDGSVEIHAEAPEEILVEFLKAVSIGPPMATVISVKYERVAGQNFTSFDIVP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A8F4E8 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 490871 | 491140 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 2 | 484033 | 484302 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 3 | 385706 | 385975 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 4 | 1778348 | 1778617 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 5 | 760336 | 760605 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 6 | 824822 | 825091 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 7 | 1115438 | 1115710 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 8 | 996651 | 996920 | + | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009828.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12850.9 | 0.75 | 6 | 1734.0 | same-strand | Calcineurin-like phosphoesterase superfamily domain |
| 2 | PF12698.9 | 0.75 | 6 | 624.0 | same-strand | ABC-2 family transporter protein |
| 3 | PF02223.19 | 0.75 | 6 | 16.0 | same-strand | Thymidylate kinase |
| 4 | PF00478.27 | 0.75 | 6 | 76.0 | opposite-strand | IMP dehydrogenase / GMP reductase domain |
| 5 | PF00571.30 | 0.75 | 6 | 76.0 | opposite-strand | CBS domain |
| 6 | PF02092.19 | 0.75 | 6 | 1557.0 | same-strand | Glycyl-tRNA synthetase beta subunit |
| 7 | PF05746.17 | 0.75 | 6 | 1557.0 | same-strand | DALR anticodon binding domain |
| 8 | PF02091.17 | 0.75 | 6 | 3569.0 | same-strand | Glycyl-tRNA synthetase alpha subunit |
| 9 | PF01314.20 | 0.75 | 6 | 4547.5 | opposite-strand | Aldehyde ferredoxin oxidoreductase, domains 2 & 3 |
| 10 | PF02730.17 | 0.75 | 6 | 4547.5 | opposite-strand | Aldehyde ferredoxin oxidoreductase, N-terminal domain |
++ More..