Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | CR931997.1 |
Organism | Corynebacterium jeikeium (strain K411) |
Left | 1118603 |
Right | 1118857 |
Strand | - |
Nucleotide Sequence | ATGCCGAACCTTGGCGTTCCTGAACTACTAATCATCGCTCTGGTCATCTTCCTGCTGTTCGGAGCGACCCGCCTGCCCAACGCAGCGCGTTCCCTGGGACGTTCGATGCGCATCTTCAAGTCCGAGATGGACGAGATGAAGACCGACGGCGACAAGAAGGAGCTGGCCGAGAAGCAGGCTCCGACCGCCGAGCAGCAGCAGGCCCAAGACCTGGCTCAGCCCAAGTCCGAGCAGCCGAACGAGCACAACGCTTAG |
Sequence | MPNLGVPELLIIALVIFLLFGATRLPNAARSLGRSMRIFKSEMDEMKTDGDKKELAEKQAPTAEQQQAQDLAQPKSEQPNEHNA |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 15968079 |
Domain | CDD:294511 |
Functional Category | Others |
Uniprot ID | Q4JVQ1 |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1575860 | 1576114 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
2 | 2841249 | 2841506 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
3 | 1464095 | 1464379 | - | NZ_CP033896.1 | Corynebacterium choanae |
4 | 2433525 | 2433779 | + | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
5 | 1093010 | 1093258 | - | NZ_CP011312.1 | Corynebacterium kutscheri |
6 | 1538048 | 1538305 | - | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03136.17 | 1.0 | 6 | 3530 | same-strand | Pup-ligase protein |
2 | PF13280.8 | 1.0 | 6 | 1010.0 | same-strand | WYL domain |
3 | PF19187.2 | 1.0 | 6 | 111.5 | same-strand | PafC helix-turn-helix domain |
4 | PF00902.20 | 1.0 | 6 | 81.0 | same-strand | Sec-independent protein translocase protein (TatC) |
5 | PF08148.14 | 1.0 | 6 | 1064 | same-strand | DSHCT (NUC185) domain |
6 | PF00270.31 | 1.0 | 6 | 1035.5 | same-strand | DEAD/DEAH box helicase |
7 | PF04851.17 | 1.0 | 6 | 1035.5 | same-strand | Type III restriction enzyme, res subunit |
8 | PF00557.26 | 0.83 | 5 | 5487 | same-strand | Metallopeptidase family M24 |
9 | PF01321.20 | 0.83 | 5 | 5487 | same-strand | Creatinase/Prolidase N-terminal domain |