| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FAD assembly factor SdhE |
| NCBI Accession ID | CP000082.1 |
| Organism | Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4) |
| Left | 2139806 |
| Right | 2140087 |
| Strand | - |
| Nucleotide Sequence | ATGACAATTAATAATCAGCCAGAGCCTACTAATGAGCAGCGCCGCATTATTTATCAAGCACGCCGTGGTCTTAAAGAATTGGATTTTTATTTTGAACCCTACATTAAAGAGCTTTATTTGACGGCTGAAGCTGCCGAACAAGAAAGCTTCGCGCAAATGCTGACTCATGAAGACCCTGATTTATTAGATTATTTTACCAATCAAAGCCGTCCAGAAGATGATGCAATGTGGGCGCTGGTCAATAAGATTAAGACGTGGCGTCATAGTAAAAGTTTGAGTTAA |
| Sequence | MTINNQPEPTNEQRRIIYQARRGLKELDFYFEPYIKELYLTAEAAEQESFAQMLTHEDPDLLDYFTNQSRPEDDAMWALVNKIKTWRHSKSLS |
| Source of smORF | Swiss-Prot |
| Function | An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID | 20154119 |
| Domain | CDD:412748 |
| Functional Category | Others |
| Uniprot ID | Q4FQX4 |
| ORF Length (Amino Acid) | 93 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2139806 | 2140087 | - | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 2 | 2481592 | 2481873 | - | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 3 | 2732893 | 2733174 | - | NZ_CP014945.1 | Psychrobacter alimentarius |
| 4 | 961419 | 961691 | - | NZ_CP012678.1 | Psychrobacter urativorans |
| 5 | 2745846 | 2746109 | + | NZ_LR884459.1 | Psychrobacter arenosus |
| 6 | 575618 | 575893 | + | NZ_CP030241.1 | Moraxella bovis |
| 7 | 1409831 | 1410103 | - | NZ_CP011381.2 | Moraxella bovoculi |
| 8 | 649559 | 649831 | + | NZ_CP011158.1 | Moraxella ovis |
| 9 | 671227 | 671493 | + | NC_014147.1 | Moraxella catarrhalis BBH18 |
| 10 | 1430314 | 1430589 | + | NZ_LR134343.1 | Moraxella cuniculi |
| 11 | 720866 | 721135 | + | NZ_CP065728.1 | Moraxella nonliquefaciens |
| 12 | 1951593 | 1951859 | + | NZ_CP014234.1 | Moraxella osloensis |
| 13 | 423894 | 424151 | + | NZ_CP044483.1 | Acinetobacter schindleri |
| 14 | 486845 | 487117 | + | NZ_CP016895.1 | Acinetobacter larvae |
| 15 | 3118182 | 3118427 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 16 | 431389 | 431649 | + | NZ_CP049916.1 | Acinetobacter lanii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF20159.1 | 0.62 | 10 | 722.0 | same-strand | YidB-like protein |