Result : Q4FNH7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP000084.1 |
| Organism | Pelagibacter ubique (strain HTCC1062) |
| Left | 434322 |
| Right | 434528 |
| Strand | + |
| Nucleotide Sequence | ATGCCAAAATTAAAAACTAAAAGTTCAGCAAAAAAAAGATTTAAAATCTCAGCTACAGGGAAAGTTATGATGGCTCAAGCTGGAAAGAGACATGGTATGATAAAAAGAACAAATTCACAAATTAGAAAATTAAGAGGCACGACTGCTATGTCAAAACAAGATGGCAAAATAGTTAAATCATACATGCCTTACAGTTTAAGAGGATAA |
| Sequence | MPKLKTKSSAKKRFKISATGKVMMAQAGKRHGMIKRTNSQIRKLRGTTAMSKQDGKIVKSYMPYSLRG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 16109880 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q4FNH7 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 326
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1417589 | 1417789 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 2 | 652176 | 652376 | + | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 3 | 373241 | 373438 | - | NZ_CP041025.1 | Paremcibacter congregatus |
| 4 | 591725 | 591925 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 5 | 3806337 | 3806537 | - | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 6 | 2559615 | 2559815 | - | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 7 | 1031375 | 1031575 | - | NZ_CP015093.1 | Salipiger abyssi |
| 8 | 4375859 | 4376059 | - | NZ_CP004393.1 | Celeribacter indicus |
| 9 | 227567 | 227767 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 10 | 1278391 | 1278591 | - | NZ_CP012023.1 | Celeribacter marinus |
| 11 | 484905 | 485105 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 12 | 454359 | 454559 | + | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 13 | 2622342 | 2622542 | - | NZ_CP041159.1 | Leisingera aquaemixtae |
| 14 | 3557117 | 3557317 | - | NZ_CP048788.1 | Roseobacter ponti |
| 15 | 41833 | 42030 | - | NZ_CP061205.1 | Kordiimonas pumila |
| 16 | 3465258 | 3465458 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 17 | 2568143 | 2568343 | - | NZ_CP016364.1 | Phaeobacter porticola |
| 18 | 712335 | 712535 | + | NZ_CP010650.1 | Phaeobacter inhibens |
| 19 | 2720467 | 2720667 | - | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 20 | 2000889 | 2001089 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 21 | 125980 | 126180 | + | NZ_CP019044.1 | Salaquimonas pukyongi |
| 22 | 498844 | 499041 | - | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 23 | 3127565 | 3127765 | + | NZ_CP027407.1 | Roseobacter denitrificans |
| 24 | 2223431 | 2223631 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
| 25 | 210033 | 210233 | + | NC_015730.1 | Roseobacter litoralis Och 149 |
| 26 | 332928 | 333125 | + | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 27 | 2566206 | 2566406 | + | NZ_CP040818.1 | Paraoceanicella profunda |
| 28 | 2604586 | 2604789 | + | NZ_CP071057.1 | Marinicauda algicola |
| 29 | 204663 | 204860 | + | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 30 | 2300052 | 2300252 | - | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 31 | 1858167 | 1858367 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 32 | 308305 | 308505 | + | NC_014217.1 | Starkeya novella DSM 506 |
| 33 | 3506530 | 3506730 | + | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 34 | 41882 | 42082 | - | NZ_CP034348.1 | Roseovarius faecimaris |
| 35 | 958873 | 959073 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 36 | 222753 | 222950 | + | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 37 | 3568334 | 3568531 | - | NZ_CP046908.1 | Stappia indica |
| 38 | 2741480 | 2741683 | + | NZ_CP053856.1 | Rhizobium pusense |
| 39 | 2856829 | 2857032 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 40 | 1958389 | 1958592 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 41 | 390507 | 390707 | - | NC_014313.1 | Hyphomicrobium denitrificans ATCC 51888 |
| 42 | 2908585 | 2908785 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 43 | 226440 | 226640 | - | NZ_CP044331.1 | Methylocystis parvus |
| 44 | 1638977 | 1639177 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 45 | 1713827 | 1714030 | - | NZ_CP039546.1 | Methylorubrum populi |
| 46 | 3821257 | 3821457 | - | NZ_CP034588.1 | Silicimonas algicola |
| 47 | 46429 | 46629 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 48 | 2507423 | 2507623 | + | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 49 | 3697083 | 3697283 | + | NZ_CP016616.1 | Microvirga ossetica |
| 50 | 310354 | 310557 | + | NZ_CP071604.1 | Rhizobium binae |
| 51 | 728368 | 728571 | - | NZ_CP049250.1 | Rhizobium rhizoryzae |
| 52 | 6124916 | 6125119 | - | NZ_CP029553.1 | Methylobacterium terrae |
| 53 | 3529789 | 3529989 | - | NZ_CP065915.1 | Pelagovum pacificum |
| 54 | 4470873 | 4471076 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 55 | 308325 | 308528 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 56 | 4524940 | 4525140 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 57 | 442095 | 442295 | - | NZ_CP010803.1 | Martelella endophytica |
| 58 | 1754548 | 1754748 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 59 | 275502 | 275705 | + | NZ_CP006877.1 | Rhizobium gallicum bv. gallicum R602sp |
| 60 | 4061999 | 4062202 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 61 | 2763690 | 2763890 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
| 62 | 3141463 | 3141666 | - | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 63 | 445572 | 445772 | + | NZ_CP032125.1 | Profundibacter amoris |
| 64 | 414135 | 414335 | - | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 65 | 3256093 | 3256293 | - | NZ_CP054836.1 | Oricola thermophila |
| 66 | 286184 | 286387 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 67 | 380612 | 380815 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 68 | 227553 | 227753 | + | NC_020911.1 | Octadecabacter antarcticus 307 |
| 69 | 3942962 | 3943162 | - | NC_020908.1 | Octadecabacter arcticus 238 |
| 70 | 157573 | 157773 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 71 | 214038 | 214241 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 72 | 4178453 | 4178656 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 73 | 6750203 | 6750403 | + | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 74 | 133434 | 133634 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 75 | 80532 | 80732 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 76 | 688954 | 689154 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 77 | 178322 | 178522 | + | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 78 | 335998 | 336198 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 79 | 155734 | 155934 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 80 | 148693 | 148893 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 81 | 67080 | 67280 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 82 | 3334530 | 3334733 | + | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 83 | 2560995 | 2561195 | - | NZ_CP060436.1 | Pseudooceanicola algae |
| 84 | 3282297 | 3282500 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 85 | 3967717 | 3967920 | + | NZ_CP029550.1 | Methylobacterium durans |
| 86 | 2758764 | 2758967 | + | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 87 | 3569258 | 3569461 | + | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 88 | 3013982 | 3014182 | - | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 89 | 2456130 | 2456330 | - | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 90 | 6803743 | 6803943 | + | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 91 | 3167566 | 3167766 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 92 | 144771 | 144971 | + | NC_017082.1 | Bradyrhizobium cosmicum |
| 93 | 2318004 | 2318204 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 94 | 145981 | 146181 | + | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 95 | 399501 | 399704 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 96 | 268241 | 268444 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 97 | 318505 | 318708 | + | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 98 | 1772081 | 1772281 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 99 | 340889 | 341092 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 100 | 327127 | 327330 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 101 | 909119 | 909322 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 102 | 1840601 | 1840801 | - | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 103 | 4552972 | 4553175 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 104 | 277762 | 277965 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 105 | 377346 | 377546 | + | NZ_CP032509.1 | Georhizobium profundi |
| 106 | 4111849 | 4112052 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 107 | 260934 | 261137 | + | NZ_CP020906.1 | Rhizobium etli |
| 108 | 2093043 | 2093246 | + | NZ_CP071454.1 | Rhizobium lentis |
| 109 | 3196706 | 3196906 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 110 | 3654706 | 3654906 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 111 | 3946327 | 3946530 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 112 | 2806957 | 2807157 | - | NZ_CP012160.1 | Octadecabacter temperatus |
| 113 | 237153 | 237353 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 114 | 3765189 | 3765389 | + | NZ_CP072611.1 | Aureimonas populi |
| 115 | 1718265 | 1718465 | + | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 116 | 42244 | 42444 | - | NC_012026.1 | Anaplasma marginale str. Florida |
| 117 | 32179 | 32379 | - | NC_013532.1 | Anaplasma centrale str. Israel |
| 118 | 22996 | 23196 | + | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 119 | 3775711 | 3775902 | - | NZ_CP033219.1 | Parasedimentitalea marina |
| 120 | 55867 | 56067 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 121 | 2393790 | 2393993 | - | NZ_CP054021.1 | Rhizobium indicum |
| 122 | 2968053 | 2968253 | - | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 123 | 653895 | 654095 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 124 | 106999 | 107202 | + | NZ_HG965802.1 | Bartonella henselae |
| 125 | 430428 | 430628 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 126 | 5667671 | 5667871 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 127 | 3594434 | 3594637 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 128 | 3788269 | 3788469 | - | NZ_CP017940.1 | Phyllobacterium zundukense |
| 129 | 2043081 | 2043281 | + | NC_004310.3 | Brucella suis 1330 |
| 130 | 2046725 | 2046925 | + | NC_009505.1 | Brucella ovis ATCC 25840 |
| 131 | 2052067 | 2052267 | + | NC_013119.1 | Brucella microti CCM 4915 |
| 132 | 2067911 | 2068111 | - | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 133 | 2068484 | 2068684 | - | NC_022905.1 | Brucella ceti TE10759-12 |
| 134 | 2056627 | 2056827 | + | NC_007618.1 | Brucella abortus 2308 |
| 135 | 650963 | 651163 | - | NZ_LT605585.1 | Brucella inopinata |
| 136 | 5061010 | 5061210 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 137 | 342487 | 342690 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 138 | 1009993 | 1010196 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 139 | 2458911 | 2459111 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 140 | 80581 | 80781 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 141 | 259313 | 259516 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 142 | 465290 | 465493 | + | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 143 | 4008213 | 4008416 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 144 | 465359 | 465562 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 145 | 3402902 | 3403105 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 146 | 443717 | 443920 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 147 | 1045873 | 1046076 | + | NZ_CP058235.1 | Bartonella alsatica |
| 148 | 545602 | 545805 | - | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 149 | 2643545 | 2643745 | + | NZ_CP064063.1 | Brucella anthropi |
| 150 | 3609086 | 3609289 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 151 | 531392 | 531595 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 152 | 720900 | 721100 | + | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 153 | 99919 | 100119 | + | NC_015684.1 | Afipia carboxidovorans OM5 |
| 154 | 2612748 | 2612948 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 155 | 641242 | 641442 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 156 | 1117574 | 1117774 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 157 | 3556734 | 3556934 | - | NZ_CP019437.1 | Thioclava nitratireducens |
| 158 | 1074899 | 1075108 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 159 | 83615 | 83818 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 160 | 88378 | 88578 | - | NC_007964.1 | Nitrobacter hamburgensis X14 |
| 161 | 364760 | 364960 | + | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 162 | 1992936 | 1993139 | - | NZ_LR134527.1 | Bartonella elizabethae |
| 163 | 97888 | 98091 | + | NZ_AP019773.1 | Bartonella quintana |
| 164 | 3206761 | 3206961 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 165 | 69184 | 69384 | - | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 166 | 98944 | 99147 | + | NC_014932.1 | Bartonella clarridgeiae 73 |
| 167 | 126947 | 127150 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 168 | 3564098 | 3564298 | - | NZ_CP053562.1 | Thioclava electrotropha |
| 169 | 419223 | 419426 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 170 | 128058 | 128261 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 171 | 835713 | 835913 | - | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 172 | 765842 | 766045 | + | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 173 | 2402784 | 2402984 | + | NZ_CP035510.1 | Haematobacter massiliensis |
| 174 | 987572 | 987772 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 175 | 774003 | 774209 | + | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 176 | 235551 | 235751 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 177 | 879608 | 879814 | + | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 178 | 1368562 | 1368765 | - | NC_008783.1 | Bartonella bacilliformis KC583 |
| 179 | 887070 | 887276 | + | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 180 | 566131 | 566337 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 181 | 884189 | 884395 | + | NC_016639.1 | Rickettsia slovaca 13-B |
| 182 | 153801 | 154001 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 183 | 236321 | 236521 | - | NZ_CP045072.1 | Paracoccus kondratievae |
| 184 | 1249913 | 1250119 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 185 | 3542859 | 3543062 | + | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 186 | 953283 | 953489 | + | NC_007940.1 | Rickettsia bellii RML369-C |
| 187 | 3304694 | 3304891 | - | NZ_CP021330.1 | Maritalea myrionectae |
| 188 | 2130576 | 2130779 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 189 | 98097 | 98300 | + | NC_020300.1 | Bartonella australis Aust/NH1 |
| 190 | 1654369 | 1654569 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 191 | 858749 | 858955 | + | NC_009881.1 | Rickettsia akari str. Hartford |
| 192 | 3071447 | 3071647 | + | NZ_AP018907.1 | Blastochloris tepida |
| 193 | 3562308 | 3562508 | - | NZ_CP012661.1 | Defluviimonas alba |
| 194 | 1510401 | 1510601 | + | NZ_CP024422.1 | Paracoccus yeei |
| 195 | 1991987 | 1992187 | + | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 196 | 42801 | 43004 | - | NZ_LN606600.1 | Acetobacter senegalensis |
| 197 | 1624063 | 1624263 | - | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 198 | 280665 | 280865 | - | NZ_CP036532.1 | Roseitalea porphyridii |
| 199 | 3663847 | 3664047 | + | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 200 | 1011253 | 1011453 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 201 | 3474691 | 3474891 | - | NZ_CP012946.1 | Blastochloris viridis |
| 202 | 203931 | 204131 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 203 | 1329598 | 1329804 | + | NZ_CP060244.1 | Entomobacter blattae |
| 204 | 900066 | 900269 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 205 | 875968 | 876174 | + | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 206 | 2402039 | 2402239 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 207 | 1991271 | 1991471 | - | NZ_CP039690.1 | Phreatobacter stygius |
| 208 | 391329 | 391535 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 209 | 2317557 | 2317757 | - | NZ_CP026100.1 | Caulobacter flavus |
| 210 | 3528343 | 3528543 | + | NZ_CP027850.1 | Caulobacter segnis |
| 211 | 3781726 | 3781926 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 212 | 3423265 | 3423468 | - | NZ_CP053708.1 | Lichenicola cladoniae |
| 213 | 1203784 | 1203984 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 214 | 1216008 | 1216211 | - | NZ_CP010522.1 | Liberibacter crescens |
| 215 | 1036221 | 1036418 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 216 | 3397164 | 3397364 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 217 | 3345790 | 3345987 | + | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 218 | 2647856 | 2648047 | - | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 219 | 2355217 | 2355420 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 220 | 1907741 | 1907941 | + | NZ_CP034328.1 | Tabrizicola piscis |
| 221 | 325096 | 325293 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 222 | 3589919 | 3590119 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 223 | 662529 | 662732 | + | NZ_CP031357.1 | Erythrobacter aureus |
| 224 | 2623904 | 2624104 | + | NZ_CP013002.1 | Caulobacter henricii |
| 225 | 5162591 | 5162794 | + | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 226 | 753725 | 753928 | - | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 227 | 2012711 | 2012911 | + | NZ_CP020470.1 | Rhodobacter blasticus |
| 228 | 1968045 | 1968248 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 229 | 876071 | 876274 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 230 | 573724 | 573927 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 231 | 938843 | 939049 | + | NZ_AP019563.1 | Rickettsia asiatica |
| 232 | 1525560 | 1525763 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 233 | 358387 | 358587 | - | NZ_CP068419.1 | Gluconobacter sphaericus |
| 234 | 251956 | 252159 | - | NZ_AP019389.1 | Qipengyuania flava |
| 235 | 462273 | 462473 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 236 | 1211400 | 1211603 | + | NZ_CP053921.1 | Erythrobacter mangrovi |
| 237 | 1763659 | 1763862 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 238 | 272014 | 272217 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 239 | 1651238 | 1651441 | + | NZ_CP024920.1 | Qipengyuania seohaensis |
| 240 | 196064 | 196267 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 241 | 998627 | 998830 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 242 | 305238 | 305441 | - | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 243 | 1853750 | 1853950 | - | NZ_CP014689.1 | Gluconobacter albidus |
| 244 | 300508 | 300711 | - | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 245 | 2659052 | 2659255 | + | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 246 | 242526 | 242729 | + | NZ_CP017057.1 | Erythrobacter litoralis |
| 247 | 2787750 | 2787953 | - | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 248 | 180763 | 180963 | + | NZ_CP047224.1 | Neorickettsia findlayensis |
| 249 | 812088 | 812291 | + | NZ_CP047045.1 | Terricaulis silvestris |
| 250 | 181585 | 181785 | + | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 251 | 2222887 | 2223090 | - | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 252 | 624283 | 624486 | + | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 253 | 192727 | 192927 | + | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 254 | 2177032 | 2177235 | - | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 255 | 439789 | 439989 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 256 | 105190 | 105393 | - | NZ_CP042306.1 | Sphingomonas panacisoli |
| 257 | 1900510 | 1900713 | + | NZ_CP022889.1 | Tsuneonella mangrovi |
| 258 | 724127 | 724330 | + | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 259 | 643109 | 643312 | + | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 260 | 1603904 | 1604107 | - | NZ_CP014681.1 | Kozakia baliensis |
| 261 | 311495 | 311698 | - | NZ_CP038141.1 | Swingsia samuiensis |
| 262 | 176371 | 176571 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 263 | 590101 | 590304 | - | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 264 | 1432430 | 1432633 | - | NZ_CP020083.1 | Blastomonas fulva |
| 265 | 2041249 | 2041449 | + | NC_010103.1 | Brucella canis ATCC 23365 |
| 266 | 551169 | 551372 | + | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 267 | 2703654 | 2703857 | - | NC_009511.1 | Sphingomonas wittichii RW1 |
| 268 | 2512540 | 2512743 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 269 | 3567763 | 3567963 | + | NZ_CP042304.1 | Devosia ginsengisoli |
| 270 | 1922699 | 1922896 | + | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 271 | 180660 | 180860 | + | NZ_CP007481.1 | Neorickettsia helminthoeca str. Oregon |
| 272 | 28841 | 29044 | - | NZ_CP037948.1 | Qipengyuania sediminis |
| 273 | 3818401 | 3818607 | - | NZ_CP044117.1 | Roseomonas mucosa |
| 274 | 3083998 | 3084201 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 275 | 638803 | 639006 | - | NZ_CP014168.1 | Sphingomonas panacis |
| 276 | 1724628 | 1724831 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 277 | 3837342 | 3837545 | + | NZ_CP009571.1 | Sphingomonas taxi |
| 278 | 4563571 | 4563774 | + | NZ_CP061038.1 | Sphingomonas alpina |
| 279 | 5024646 | 5024849 | - | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 280 | 4284876 | 4285079 | - | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 281 | 2316164 | 2316367 | - | NZ_CP060717.1 | Sphingomonas rhizophila |
| 282 | 2727535 | 2727738 | + | NZ_CP060035.1 | Sphingobium fuliginis |
| 283 | 3430998 | 3431201 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 284 | 1779965 | 1780168 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 285 | 2471780 | 2471983 | - | NZ_CP060782.1 | Sphingomonas sediminicola |
| 286 | 1143147 | 1143350 | + | NZ_CP060780.1 | Sphingomonas daechungensis |
| 287 | 2227349 | 2227552 | - | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 288 | 1222678 | 1222881 | - | NZ_CP041659.1 | Sphingomonas xanthus |
| 289 | 753095 | 753298 | - | NZ_CP022745.1 | Sphingobium xenophagum |
| 290 | 2379948 | 2380151 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 291 | 1484194 | 1484394 | + | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 292 | 204715 | 204912 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 293 | 1173684 | 1173887 | + | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 294 | 349011 | 349211 | + | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 295 | 5008911 | 5009111 | - | NZ_CP030265.1 | Skermanella pratensis |
| 296 | 468319 | 468519 | + | NZ_LN832559.1 | Paracoccus aminovorans |
| 297 | 570043 | 570246 | + | NZ_CP010401.1 | Bartonella ancashensis |
| 298 | 327595 | 327795 | + | NZ_CP030918.1 | Paracoccus suum |
| 299 | 2402527 | 2402730 | - | NZ_CP023705.1 | Sphingomonas melonis |
| 300 | 325934 | 326137 | - | NZ_CP060718.1 | Sphingomonas lutea |
| 301 | 257306 | 257506 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 302 | 2712385 | 2712585 | - | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 303 | 3766372 | 3766578 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 304 | 812648 | 812851 | - | NZ_CP016033.1 | Erythrobacter neustonensis |
| 305 | 3129657 | 3129854 | + | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 306 | 1004351 | 1004548 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 307 | 226685 | 226885 | + | NZ_CP042906.1 | Hypericibacter terrae |
| 308 | 2139783 | 2139980 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 309 | 445850 | 446050 | + | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 310 | 271487 | 271687 | + | NZ_CP042582.1 | Hypericibacter adhaerens |
| 311 | 434617 | 434814 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 312 | 752722 | 752919 | + | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 313 | 2462106 | 2462306 | + | NZ_CP029353.1 | Azospirillum thermophilum |
| 314 | 4324033 | 4324230 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 315 | 2014236 | 2014433 | - | NZ_CP041185.1 | Janthinobacterium tructae |
| 316 | 4786145 | 4786348 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 317 | 2643275 | 2643478 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 318 | 1002866 | 1003060 | + | NZ_LT593929.1 | Propionibacterium freudenreichii |
| 319 | 1731976 | 1732173 | - | NC_012968.1 | Methylotenera mobilis JLW8 |
| 320 | 1766405 | 1766602 | - | NZ_LR134404.1 | Weeksella virosa |
| 321 | 4321760 | 4321957 | + | NZ_CP015199.1 | Chryseobacterium glaciei |
| 322 | 1492412 | 1492615 | - | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 323 | 902980 | 903177 | + | NZ_CP007501.1 | Polynucleobacter duraquae |
| 324 | 255499 | 255696 | - | NZ_LR134503.1 | Kaistella jeonii |
| 325 | 1976204 | 1976401 | - | NC_014207.1 | Methylotenera versatilis 301 |
| 326 | 3032072 | 3032266 | + | NZ_CP018477.1 | Thermogutta terrifontis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP041025.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00453.20 | 1.0 | 326 | 25.5 | same-strand | Ribosomal protein L20 |
| 2 | PF01409.22 | 0.82 | 267 | 600 | same-strand | tRNA synthetases class II core domain (F) |
| 3 | PF02912.20 | 0.81 | 264 | 600.5 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 4 | PF03483.19 | 0.69 | 226 | 1878.5 | same-strand | B3/4 domain |
| 5 | PF17759.3 | 0.68 | 223 | 1867.0 | same-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
| 6 | PF03147.16 | 0.69 | 225 | 1888 | same-strand | Ferredoxin-fold anticodon binding domain |
| 7 | PF01588.22 | 0.69 | 226 | 1888 | same-strand | Putative tRNA binding domain |
| 8 | PF03484.17 | 0.69 | 226 | 1878.5 | same-strand | tRNA synthetase B5 domain |
++ More..