Result : Q4FN40
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S21 |
| NCBI Accession ID | CP000084.1 |
| Organism | Pelagibacter ubique (strain HTCC1062) |
| Left | 568515 |
| Right | 568709 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATAGAAGTCAAAGATAACAATATTGAACAAGCACTTAGAGTTCTTAAAAGAAAATTACAAAGAGATGGTTTTTTTAAAGTAGTAAAATTAAAAAGTGTTTACGAAAAACCTTCTGAAAAGAAAAAAAGAATTTTACAAGAAAATATTAAAAGAGTTAAAAAGCTTAATAAGCTTAAAAATAGAATTTAA |
| Sequence | MKIEVKDNNIEQALRVLKRKLQRDGFFKVVKLKSVYEKPSEKKKRILQENIKRVKKLNKLKNRI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | 16109880 |
| Domain | CDD:412427 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q4FN40 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 90
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2865107 | 2865313 | + | NZ_CP032125.1 | Profundibacter amoris |
| 2 | 652314 | 652520 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 3 | 243756 | 243962 | - | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 4 | 2492257 | 2492457 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 5 | 394956 | 395162 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 6 | 4431966 | 4432166 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 7 | 2601973 | 2602179 | + | NZ_CP041159.1 | Leisingera aquaemixtae |
| 8 | 2564992 | 2565198 | + | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 9 | 2940435 | 2940641 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
| 10 | 460399 | 460605 | - | NZ_CP016364.1 | Phaeobacter porticola |
| 11 | 3056618 | 3056824 | + | NZ_CP010650.1 | Phaeobacter inhibens |
| 12 | 387286 | 387492 | - | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 13 | 3041718 | 3041924 | - | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 14 | 2550017 | 2550223 | + | NZ_CP060436.1 | Pseudooceanicola algae |
| 15 | 3229468 | 3229674 | - | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 16 | 3532746 | 3532952 | + | NZ_CP048788.1 | Roseobacter ponti |
| 17 | 602669 | 602875 | - | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 18 | 3517560 | 3517766 | + | NZ_CP065915.1 | Pelagovum pacificum |
| 19 | 248574 | 248780 | - | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 20 | 3158854 | 3159060 | - | NZ_CP027407.1 | Roseobacter denitrificans |
| 21 | 473468 | 473674 | - | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 22 | 241164 | 241370 | - | NC_015730.1 | Roseobacter litoralis Och 149 |
| 23 | 3663348 | 3663554 | - | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 24 | 1953841 | 1954044 | - | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 25 | 1854799 | 1855005 | - | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 26 | 2796577 | 2796783 | + | NZ_CP012160.1 | Octadecabacter temperatus |
| 27 | 3016208 | 3016414 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 28 | 1154152 | 1154358 | - | NZ_CP015421.1 | Rhodovulum sulfidophilum |
| 29 | 501696 | 501902 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 30 | 3164599 | 3164805 | - | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 31 | 1147324 | 1147530 | + | NZ_CP015093.1 | Salipiger abyssi |
| 32 | 3812797 | 3813003 | + | NZ_CP034588.1 | Silicimonas algicola |
| 33 | 359600 | 359806 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 34 | 3479736 | 3479936 | - | NC_020908.1 | Octadecabacter arcticus 238 |
| 35 | 296344 | 296550 | - | NC_020908.1 | Octadecabacter arcticus 238 |
| 36 | 661819 | 662019 | - | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 37 | 1410237 | 1410437 | + | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 38 | 3757758 | 3757964 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 39 | 3890673 | 3890879 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 40 | 2371621 | 2371827 | - | NZ_CP039964.1 | Pseudorhodobacter turbinis |
| 41 | 2299488 | 2299694 | + | NZ_CP020470.1 | Rhodobacter blasticus |
| 42 | 211662 | 211868 | + | NZ_CP010522.1 | Liberibacter crescens |
| 43 | 2009293 | 2009499 | + | NZ_CP034328.1 | Tabrizicola piscis |
| 44 | 241391 | 241597 | - | NZ_CP045072.1 | Paracoccus kondratievae |
| 45 | 1839939 | 1840142 | - | NZ_CP060244.1 | Entomobacter blattae |
| 46 | 979233 | 979439 | - | NZ_CP020612.1 | Paracoccus contaminans |
| 47 | 482380 | 482586 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 48 | 340786 | 340992 | - | NZ_CP030918.1 | Paracoccus suum |
| 49 | 1520386 | 1520592 | - | NZ_CP024422.1 | Paracoccus yeei |
| 50 | 2001973 | 2002179 | - | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 51 | 361921 | 362127 | - | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 52 | 503235 | 503441 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 53 | 3659039 | 3659245 | + | NZ_CP019437.1 | Thioclava nitratireducens |
| 54 | 3668172 | 3668378 | + | NZ_CP053562.1 | Thioclava electrotropha |
| 55 | 4667135 | 4667341 | - | NZ_CP012661.1 | Defluviimonas alba |
| 56 | 1478757 | 1478963 | - | NZ_CP011452.2 | Croceibacterium atlanticum |
| 57 | 2353369 | 2353575 | - | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 58 | 352484 | 352690 | - | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 59 | 2755958 | 2756176 | + | NZ_CP019044.1 | Salaquimonas pukyongi |
| 60 | 2271187 | 2271393 | + | NZ_CP035510.1 | Haematobacter massiliensis |
| 61 | 1716124 | 1716330 | + | NZ_CP025583.1 | Paracoccus jeotgali |
| 62 | 3165957 | 3166169 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 63 | 3491572 | 3491778 | + | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 64 | 846982 | 847188 | - | NZ_CP024920.1 | Qipengyuania seohaensis |
| 65 | 2548529 | 2548735 | - | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 66 | 2795098 | 2795304 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 67 | 2208011 | 2208217 | + | NZ_CP022196.1 | Celeribacter ethanolicus |
| 68 | 4361501 | 4361707 | + | NZ_CP004393.1 | Celeribacter indicus |
| 69 | 228894 | 229100 | - | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 70 | 339076 | 339282 | - | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 71 | 265740 | 265952 | + | NZ_CP010803.1 | Martelella endophytica |
| 72 | 3448337 | 3448543 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 73 | 377142 | 377348 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 74 | 2860234 | 2860440 | + | NZ_CP020083.1 | Blastomonas fulva |
| 75 | 1265209 | 1265415 | + | NZ_CP012023.1 | Celeribacter marinus |
| 76 | 1051396 | 1051602 | + | NZ_AP019389.1 | Qipengyuania flava |
| 77 | 2316008 | 2316214 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 78 | 2371388 | 2371594 | - | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 79 | 2565235 | 2565441 | - | NZ_CP017057.1 | Erythrobacter litoralis |
| 80 | 667675 | 667881 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 81 | 2039377 | 2039583 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 82 | 1204912 | 1205118 | + | NZ_CP031357.1 | Erythrobacter aureus |
| 83 | 2822549 | 2822761 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 84 | 3297180 | 3297392 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 85 | 3295897 | 3296109 | + | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 86 | 3210983 | 3211189 | + | NZ_CP060035.1 | Sphingobium fuliginis |
| 87 | 1432304 | 1432528 | + | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 88 | 1559165 | 1559368 | - | NZ_CP031555.1 | Thalassospira indica |
| 89 | 2106827 | 2107033 | - | NZ_CP040818.1 | Paraoceanicella profunda |
| 90 | 1571099 | 1571302 | + | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 91 | 1457929 | 1458135 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 92 | 2257473 | 2257664 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 93 | 2836390 | 2836587 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 94 | 1734704 | 1734898 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 95 | 2687670 | 2687864 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 96 | 2388699 | 2388905 | - | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032125.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00107.28 | 0.6 | 54 | 840.0 | opposite-strand | Zinc-binding dehydrogenase |
| 2 | PF13602.8 | 0.6 | 54 | 842 | opposite-strand | Zinc-binding dehydrogenase |
| 3 | PF08511.13 | 0.66 | 59 | 113 | opposite-strand | COQ9 |
++ More..